You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LIN54
Protein lin-54 homolog

Protein Summary
Description
Component of the DREAM complex, a multiprotein complex that can both act as a transcription activator or repressor depending on the context (PubMed:17671431, PubMed:17531812). In G0 phase, the complex binds to more than 800 promoters and is required for repression of E2F target genes (PubMed:17671431, PubMed:17531812). In S phase, the complex selectively binds to the promoters of G2/M genes whose products are required for mitosis and participates in their cell cycle dependent activation (PubMed:17671431, PubMed:17531812). In the complex, acts as a DNA-binding protein that binds the promoter of CDK1 in a sequence-specific manner (PubMed:19725879). Specifically recognizes the consensus motif 5'-TTYRAA-3' in target DNA (PubMed:27465258). LIN54 is a component of the LIN, or DREAM, complex, an essential regulator of cell cycle genes (Schmit et al., 2009 [PubMed 19725879]).[supplied by OMIM, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340417
  • ENSP00000341947
  • ENSG00000189308
  • ENST00000442461
  • ENSP00000398265
  • ENST00000446851
  • ENSP00000407139
  • ENST00000505397
  • ENSP00000425844
  • ENST00000506560
  • ENSP00000423475
  • ENST00000508171
  • ENSP00000427413
  • ENST00000510557
  • ENSP00000421045

Symbol
  • CXCDC1
  • KIAA2037
  • TCX1
  • JC8.6
  • CXCDC1
  • MIP120
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor
0.77
microRNA
0.7
transcription factor binding site profile
0.66
tissue sample
0.65
tissue
0.55


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.96   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 54   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 23.96   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 54   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (15)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle, Mitotic
Reactome
Cyclin A:Cdk2-associated events at S phase entry
Reactome
Cyclin E associated events during G1/S transition
Reactome
G0 and Early G1
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle, Mitotic
Cyclin A:Cdk2-associated events at S phase entry
Cyclin E associated events during G1/S transition
G0 and Early G1
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (76)
1 – 10 of 76
LIN37
Tbio
Novelty: 0.0949829
p_int: 0.999999955
p_ni: 4.5e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
LIN9
Tbio
Novelty: 0.00193435
p_int: 0.999998709
p_ni: 0.00000129
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
MYBL1
Tbio
Family: TF
Novelty: 0.00928024
p_int: 0.999994152
p_ni: 0.000005849
Score: 0.918
Data Source: BioPlex,STRINGDB
RPN2
Tbio
Family: Enzyme
Novelty: 0.02322923
p_int: 0.999986811
p_ni: 0.000013189
Score: 0.561
Data Source: BioPlex,STRINGDB
L3MBTL2
Tbio
Family: Epigenetic
Novelty: 0.13882316
p_int: 0.999968901
p_ni: 0.000031099
Score: 0.34
Data Source: BioPlex,STRINGDB
CCDC74A
Tdark
p_int: 0.999957239
p_ni: 0.000042761
Data Source: BioPlex
TUSC3
Tbio
Novelty: 0.01081706
p_int: 0.999447359
p_ni: 0.00055162
p_wrong: 0.000001021
Score: 0.419
Data Source: BioPlex,STRINGDB
IKZF5
Tbio
Family: TF
Novelty: 1
p_int: 0.999306227
p_ni: 0.0006935
p_wrong: 2.73e-7
Score: 0.189
Data Source: BioPlex,STRINGDB
SPINT2
Tbio
Family: Enzyme
Novelty: 0.00575409
p_int: 0.998816932
p_ni: 0.001182958
p_wrong: 1.11e-7
Data Source: BioPlex
PSMC3
Tbio
Family: Enzyme
Novelty: 0.0502828
p_int: 0.992751546
p_ni: 0.007248437
p_wrong: 1.7e-8
Score: 0.177
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  23.96

PubMed score by year
PubTator Score  5.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEVVPAEVNSLLPEEIMDTGITLVDDDSIEAVIVSSPIPMETELEEIVNINSTGDSTATPISTEPITVYS
1-70
NHTNQVAVNTTITKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKVSQTSDLKLGNQTLKPDGQKL
70-140
ILTTLGKSGSPIVLALPHSQLPQAQKVTTQAQSGDAKLPPQQIKVVTIGGRPEVKPVIGVSALTPGSQLI
140-210
NTTTQPSVLQTQQLKTVQIAKKPRTPTSGPVITKLIFAKPINSKAVTGQTTQVSPPVIAGRVLSQSTPGT
210-280
PSKTITISESGVIGSTLNSTTQTPNKIAISPLKSPNKAVKSTVQTITVGGVSTSQFKTIIPLATAPNVQQ
280-350
IQVPGSKFHYVRLVTATSASSSTQPVSQNPSTNTQPLQQAKPVVVNTTPVRMSVPIVSAQAVKQVVPKPI
350-420
NPTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQLQQSSYVSIA
420-490
SNSTFTGTSGIQTQARLPFNGIIPSESASRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEH
490-560
ENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCK
560-630
NFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNC
630-700
LLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKAKSDPCAMNC
700-749
MEVVPAEVNSLLPEEIMDTGITLVDDDSIEAVIVSSPIPMETELEEIVNINSTGDSTATPISTEPITVYSNHTNQVAVNTTITKADSNTTVKPAFPSGLQKLGAQTPVTISANQIILNKVSQTSDLKLGNQTLKPDGQKLILTTLGKSGSPIVLALPHSQLPQAQKVTTQAQSGDAKLPPQQIKVVTIGGRPEVKPVIGVSALTPGSQLINTTTQPSVLQTQQLKTVQIAKKPRTPTSGPVITKLIFAKPINSKAVTGQTTQVSPPVIAGRVLSQSTPGTPSKTITISESGVIGSTLNSTTQTPNKIAISPLKSPNKAVKSTVQTITVGGVSTSQFKTIIPLATAPNVQQIQVPGSKFHYVRLVTATSASSSTQPVSQNPSTNTQPLQQAKPVVVNTTPVRMSVPIVSAQAVKQVVPKPINPTSQIVTTSQPQQRLIMPATPLPQIQPNLTNLPPGTVLAPAPGTGNVGYAVLPAQYVTQLQQSSYVSIASNSTFTGTSGIQTQARLPFNGIIPSESASRPRKPCNCTKSLCLKLYCDCFANGEFCNNCNCTNCYNNLEHENERQKAIKACLDRNPEAFKPKIGKGKEGESDRRHSKGCNCKRSGCLKNYCECYEAKIMCSSICKCIGCKNFEESPERKTLMHLADAAEVRVQQQTAAKTKLSSQISDLLTRPTPALNSGGGKLPFTFVTKEVAEATCNCLLAQAEQADKKGKSKAAAERMILEEFGRCLMSVINSAGKAKSDPCAMNC