You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RCSD1
CapZ-interacting protein

Protein Summary
Description
Stress-induced phosphorylation of CAPZIP may regulate the ability of F-actin-capping protein to remodel actin filament assembly.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000367854
  • ENSP00000356828
  • ENSG00000198771

Symbol
  • CAPZIP
  • MK2S4
  • CAPZIP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.66
histone modification site profile
0.64
transcription factor binding site profile
0.64
disease perturbation
0.62
tissue sample
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.04   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 69   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.04   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 69   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
BHF-UCL
Protein-Protein Interactions (61)
1 – 10 of 61
CAPZA2
Tdark
Novelty: 0.27435063
p_int: 0.999995129
p_ni: 0.000004871
Score: 0.722
Data Source: BioPlex,STRINGDB
CAPZB
Tbio
Novelty: 0.04913074
p_int: 0.999748504
p_ni: 0.000251496
Score: 0.86
Data Source: BioPlex,STRINGDB
CAPZA1
Tbio
Novelty: 0.04371834
p_int: 0.998908883
p_ni: 0.001091117
Score: 0.959
Data Source: BioPlex,STRINGDB
TMOD4
Tbio
Novelty: 0.01074829
Score: 0.8
Data Source: STRINGDB
MAPK12
Tchem
Family: Kinase
Novelty: 0.01020422
Score: 0.793
Data Source: STRINGDB
MAPKAPK3
Tchem
Family: Kinase
Novelty: 0.01845634
Score: 0.741
Data Source: STRINGDB
MAPKAPK2
Tchem
Family: Kinase
Novelty: 0.00521234
Score: 0.731
Data Source: STRINGDB
MAPK13
Tchem
Family: Kinase
Novelty: 0.00235189
Score: 0.719
Data Source: STRINGDB
P4HA3
Tbio
Family: Enzyme
Novelty: 0.04334371
Score: 0.696
Data Source: STRINGDB
ARHGAP25
Tdark
Family: Enzyme
Novelty: 0.22612876
Score: 0.696
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.04

PubMed score by year
PubTator Score  6.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSLPLFPPKVDLGQNGEEKSPP
1-70
NASHPPKFKVKSSPLIEKLQANLTFDPAALLPGASPKSPGLKAMVSPFHSPPSTPSSPGVRSRPSEAEEV
70-140
PVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSDCGELGDFRAVESSQQNGAKEEDGDEVLPSK
140-210
SKAPGSPLSSEGAAGEGVRTLGPAEKPPLRRSPSRTEKQEEDRATEEAKNGEKARRSSEEVDGQHPAQEE
210-280
VPESPQTSGPEAENRCGSPREEKPAGEEAEMEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPH
280-350
SPPGGVKGGDVPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM
350-416
MEERPAETNANVDNSASPSVAQLAGRFREQAAAAKETPASKPTRRKPPCSLPLFPPKVDLGQNGEEKSPPNASHPPKFKVKSSPLIEKLQANLTFDPAALLPGASPKSPGLKAMVSPFHSPPSTPSSPGVRSRPSEAEEVPVSFDQPPEGSHLPCYNKVRTRGSIKRRPPSRRFRRSQSDCGELGDFRAVESSQQNGAKEEDGDEVLPSKSKAPGSPLSSEGAAGEGVRTLGPAEKPPLRRSPSRTEKQEEDRATEEAKNGEKARRSSEEVDGQHPAQEEVPESPQTSGPEAENRCGSPREEKPAGEEAEMEKATEVKGERVQNEEVGPEHDSQETKKLEEGAAVKETPHSPPGGVKGGDVPKQEKGKEKQQEGAVLEPGCSPQTGPAQLETSSEVQSEPAVPKPEDDTPVQDTKM