You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
FAM166A
Protein FAM166A

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000344774
  • ENSP00000344729
  • ENSG00000188163

Symbol
  • HSD46
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.71
cell line
0.51
cell type or tissue
0.5
tissue
0.49
tissue sample
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 57   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 57   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (20)
1 – 10 of 20
TEX38
Tdark
Score: 0.672
Data Source: STRINGDB
PRR30
Tdark
Novelty: 20
Score: 0.647
Data Source: STRINGDB
FAM205A
Tdark
Score: 0.642
Data Source: STRINGDB
FAM71F1
Tdark
Novelty: 0.34361233
Score: 0.591
Data Source: STRINGDB
ARMC12
Tdark
Novelty: 1.27272727
Score: 0.584
Data Source: STRINGDB
FRG2
Tbio
Novelty: 0.1472909
Score: 0.558
Data Source: STRINGDB
LYZL6
Tbio
Family: Enzyme
Novelty: 0.09752322
Score: 0.552
Data Source: STRINGDB
TPPP2
Tdark
Novelty: 0.28354222
Score: 0.539
Data Source: STRINGDB
SPACA4
Tdark
Novelty: 0.3957382
Score: 0.534
Data Source: STRINGDB
HCFC1R1
Tbio
Score: 0.53
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MTTTQKHDLFTPEPHYVPGYAGFFPQLRYQVGNTYGRTTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQ
1-70
SKPPRVPCQDLTEPYIPHYTSLKPSKNFEILGQLPPLEVDAQEPPGVENIPRQILLPAGFTPDTPHPPCP
70-140
PGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQRDEYPPPARRQQETLDVGSFQRLPQLDHPNL
140-210
IQRKAISGYAGFIPRFTWVMGLNYRDGVMQAMDEFDKSQFLFRNPHCDLGEKLPGTHWPSNHIYSSQGLI
210-280
PFYMGFIPAMQDNYALTFGNSTRRAYWKEWAKRNHTL
280-317
MTTTQKHDLFTPEPHYVPGYAGFFPQLRYQVGNTYGRTTGQLLTDPSVQKSPCSVLSPMSKPKFIEDFSQSKPPRVPCQDLTEPYIPHYTSLKPSKNFEILGQLPPLEVDAQEPPGVENIPRQILLPAGFTPDTPHPPCPPGRKGDSRDLGHPVYGEEAWKSATPVCEAPRQHQLYHCQRDEYPPPARRQQETLDVGSFQRLPQLDHPNLIQRKAISGYAGFIPRFTWVMGLNYRDGVMQAMDEFDKSQFLFRNPHCDLGEKLPGTHWPSNHIYSSQGLIPFYMGFIPAMQDNYALTFGNSTRRAYWKEWAKRNHTL