You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PTCRA
Pre T-cell antigen receptor alpha

Protein Summary
Description
The pre-T-cell receptor complex (composed of PTCRA, TCRB and the CD3 complex) regulates early T-cell development. The protein encoded by this gene is a single-pass type I membrane protein that is found in immmature but not mature T-cells. Along with TCRB and CD3 complex, the encoded protein forms the pre-T-cell receptor complex, which regulates early T-cell development. Four transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000304672
  • ENSP00000304447
  • ENSG00000171611
  • ENST00000441198
  • ENSP00000409550
  • ENST00000446507
  • ENSP00000392288

Symbol
  • PTA
  • PT-ALPHA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.69
cell line
0.54
gene perturbation
0.52
small molecule perturbation
0.52
disease perturbation
0.49


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1030.59   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 114   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1030.59   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 114   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (13)
NOTCH3 Intracellular Domain Regulates Transcription (R-HSA-9013508)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
NOTCH3 Intracellular Domain Regulates Transcription
Reactome
Signal Transduction
Reactome
Signaling by NOTCH
Reactome
Signaling by NOTCH3
Name
Explore in Pharos
Explore in Source
NOTCH3 Intracellular Domain Regulates Transcription
Signal Transduction
Signaling by NOTCH
Signaling by NOTCH3
Gene Ontology Terms (2)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (56)
1 – 10 of 56
TCEA1
Tbio
Novelty: 0.00218057
p_int: 0.978438939
p_ni: 0.021560972
p_wrong: 8.9e-8
Score: 0.219
Data Source: BioPlex,STRINGDB
CTH
Tchem
Family: Enzyme
Novelty: 0.00197728
p_int: 0.880320188
p_ni: 0.119638144
p_wrong: 0.000041668
Score: 0.239
Data Source: BioPlex,STRINGDB
FEN1
Tchem
Family: Enzyme
Novelty: 0.00147856
p_int: 0.858701917
p_ni: 0.141298082
Score: 0.309
Data Source: BioPlex,STRINGDB
NOTCH3
Tchem
Novelty: 0.00119412
Score: 0.962
Data Source: STRINGDB
RBPJ
Tbio
Family: TF
Novelty: 0.00198074
Score: 0.923
Data Source: STRINGDB
MAML1
Tbio
Novelty: 0.0200407
Score: 0.913
Data Source: STRINGDB
MAMLD1
Tbio
Novelty: 0.00954239
Score: 0.904
Data Source: STRINGDB
MAML2
Tbio
Novelty: 0.01290922
Score: 0.902
Data Source: STRINGDB
MAML3
Tbio
Novelty: 0.0824416
Score: 0.9
Data Source: STRINGDB
HID1
Tdark
Novelty: 2
Score: 0.716
Data Source: STRINGDB
Publication Statistics
PubMed Score  1030.59

PubMed score by year
PubTator Score  117.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSA
1-70
LDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQPMHLSGEASTARTCPQEPL
70-140
RGTPGGALWLGVLRLLLFKLLLFDLLLTCSCLCDPAGPLPSPATTTRLRALGSHRLHPATETGGREATSS
140-210
PRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGA
210-280
A
280-281
MAGTWLLLLLALGCPALPTGVGGTPFPSLAPPIMLLVDGKQQMVVVCLVLDVAPPGLDSPIWFSAGNGSALDAFTYGPSPATDGTWTNLAHLSLPSEELASWEPLVCHTGPGAEGHSRSTQPMHLSGEASTARTCPQEPLRGTPGGALWLGVLRLLLFKLLLFDLLLTCSCLCDPAGPLPSPATTTRLRALGSHRLHPATETGGREATSSPRPQPRDRRWGDTPPGRKPGSPVWGEGSYLSSYPTCPAQAWCSRSALRAPSSSLGAFFAGDLPPPLQAGAA