You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
GPR139
Probable G-protein coupled receptor 139

Protein Summary
Description
Orphan receptor. Seems to act through a G(q/11)-mediated pathway. This gene encodes a member of the rhodopsin family of G-protein-coupled receptors. The encoded protein is almost exclusively expressed in the central nervous system. L-tryptophan and L-phenylalanine may act as the physiologic ligands of the encoded protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000570682
  • ENSP00000458791
  • ENSG00000180269

Symbol
  • GPRG1
  • PGR3
  • PGR3
  • GPRg1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.61
cell line
0.59
molecular function
0.49
PubMedID
0.49
phenotype
0.37


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.2   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 137   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.2   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 137   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 20
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (20)
1 – 10 of 20
L-tryptophan
chemical structure image
L-phenylalanine
chemical structure image
CHEMBL3633720
chemical structure image
CHEMBL3633714
chemical structure image
CHEMBL3633884
chemical structure image
compound 1a [PMID: 24900311]
chemical structure image
CHEMBL3633878
chemical structure image
CHEMBL3633890
chemical structure image
CHEMBL3633881
chemical structure image
CHEMBL3633880
chemical structure image
Protein-Protein Interactions (31)
1 – 10 of 31
GPR146
Tdark
Family: GPCR
Novelty: 0.27164686
Score: 0.788
Data Source: STRINGDB
GPR141
Tdark
Family: GPCR
Novelty: 0.28510819
Score: 0.759
Data Source: STRINGDB
GPR148
Tbio
Family: GPCR
Novelty: 0.00638019
Score: 0.737
Data Source: STRINGDB
ADGRF2
Tdark
Family: GPCR
Novelty: 1.76986065
Score: 0.726
Data Source: STRINGDB
ADGRF1
Tbio
Family: GPCR
Novelty: 0.10623737
Score: 0.716
Data Source: STRINGDB
NPSR1
Tchem
Family: GPCR
Novelty: 0.00598831
Score: 0.713
Data Source: STRINGDB
GPR83
Tchem
Family: GPCR
Novelty: 0.00387776
Score: 0.71
Data Source: STRINGDB
GPR162
Tbio
Family: GPCR
Novelty: 0.1214531
Score: 0.665
Data Source: STRINGDB
GPR153
Tdark
Family: GPCR
Novelty: 0.62164662
Score: 0.635
Data Source: STRINGDB
GPR12
Tbio
Family: GPCR
Novelty: 0.06677423
Score: 0.625
Data Source: STRINGDB
Publication Statistics
PubMed Score  19.20

PubMed score by year
PubTator Score  14.9

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEHTHAHLAANSSLSWWSPGSACGLGFVPVVYYSLLLCLGLPANILTVIILSQLVARRQKSSYNYLLALA
1-70
AADILVLFFIVFVDFLLEDFILNMQMPQVPDKIIEVLEFSSIHTSIWITVPLTIDRYIAVCHPLKYHTVS
70-140
YPARTRKVIVSVYITCFLTSIPYYWWPNIWTEDYISTSVHHVLIWIHCFTVYLVPCSIFFILNSIIVYKL
140-210
RRKSNFRLRGYSTGKTTAILFTITSIFATLWAPRIIMILYHLYGAPIQNRWLVHIMSDIANMLALLNTAI
210-280
NFFLYCFISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDKNGKPIK
280-350
VSP
350-353
MEHTHAHLAANSSLSWWSPGSACGLGFVPVVYYSLLLCLGLPANILTVIILSQLVARRQKSSYNYLLALAAADILVLFFIVFVDFLLEDFILNMQMPQVPDKIIEVLEFSSIHTSIWITVPLTIDRYIAVCHPLKYHTVSYPARTRKVIVSVYITCFLTSIPYYWWPNIWTEDYISTSVHHVLIWIHCFTVYLVPCSIFFILNSIIVYKLRRKSNFRLRGYSTGKTTAILFTITSIFATLWAPRIIMILYHLYGAPIQNRWLVHIMSDIANMLALLNTAINFFLYCFISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCIKMLVYQYDKNGKPIKVSP