You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CDCA2
Cell division cycle-associated protein 2

Protein Summary
Description
Regulator of chromosome structure during mitosis required for condensin-depleted chromosomes to retain their compact architecture through anaphase. Acts by mediating the recruitment of phopsphatase PP1-gamma subunit (PPP1CC) to chromatin at anaphase and into the following interphase. At anaphase onset, its association with chromatin targets a pool of PPP1CC to dephosphorylate substrates. This gene encodes a targeting subunit of the cell-cycle associated protein, protein phosphatase 1, with a role in targeting this protein to chromatin during anaphase. These two proteins comprise a phosphatase complex that is involved in nuclear envelope reformation and regulation of the DNA damage response. The encoded protein may also play a role in cancer progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000330560
  • ENSP00000328228
  • ENSG00000184661

Symbol
  • PPP1R81
  • Repo-Man
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor binding site profile
0.77
transcription factor perturbation
0.68
histone modification site profile
0.6
kinase perturbation
0.6
PubMedID
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.68   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 116   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.68   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 116   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (6)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
HPA
Protein-Protein Interactions (169)
1 – 10 of 169
PPP1CC
Tchem
Family: Enzyme
Novelty: 0.00538884
p_int: 0.999999987
p_ni: 1.2e-8
p_wrong: 1e-9
Score: 0.489
Data Source: BioPlex,STRINGDB
PPP1CA
Tchem
Family: Enzyme
Novelty: 0.00685545
p_int: 0.999999912
p_ni: 6.1e-8
p_wrong: 2.6e-8
Score: 0.32
Data Source: BioPlex,STRINGDB
KPNA2
Tbio
Novelty: 0.00784264
p_int: 0.999995601
p_ni: 0.000004399
Score: 0.82
Data Source: BioPlex,STRINGDB
JMJD6
Tbio
Family: Enzyme
Novelty: 0.00134844
p_int: 0.999987557
p_ni: 0.000012443
Data Source: BioPlex
NUP50
Tbio
Novelty: 0.05793903
p_int: 0.999668048
p_ni: 0.000331902
p_wrong: 4.9e-8
Score: 0.611
Data Source: BioPlex,STRINGDB
RAN
Tbio
Family: Enzyme
Novelty: 0.00230621
p_int: 0.999148146
p_ni: 0.000851854
Score: 0.209
Data Source: BioPlex,STRINGDB
IER2
Tbio
Novelty: 0.05396246
p_int: 0.997239258
p_ni: 0.002712398
p_wrong: 0.000048344
Score: 0.179
Data Source: BioPlex,STRINGDB
TCEAL1
Tbio
Novelty: 0.03807394
p_int: 0.995735639
p_ni: 0.004264191
p_wrong: 1.69e-7
Data Source: BioPlex
B2M
Tbio
Novelty: 0.00012184
p_int: 0.976364702
p_ni: 0.021044365
p_wrong: 0.002590932
Score: 0.183
Data Source: BioPlex,STRINGDB
PBK
Tchem
Family: Kinase
Novelty: 0.00332152
Score: 0.907
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.68

PubMed score by year
PubTator Score  16.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDANSKDKPPETKESAMNNAGNASFILGTGKIVTPQKHAELPPNPCTPDTFKSPLNFSTVTVEQLGITPE
1-70
SFVRNSAGKSSSYLKKCRRRSAVGARGSPETNHLIRFIARQQNIKNARKSPLAQDSPSQGSPALYRNVNT
70-140
LRERISAFQSAFHSIKENEKMTGCLEFSEAGKESEMTDLTRKEGLSACQQSGFPAVLSSKRRRISYQRDS
140-210
DENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADC
210-280
VVGKGSSDAVSPDTFTAEVSSDAVPDVRSPATPACRRDLPTPKTFVLRSVLKKPSVKMCLESLQEHCNNL
280-350
YDDDGTHPSLISNLPNCCKEKEAEDEENFEAPAFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTP
350-420
VCKKDFSGLSSLLLEQSPVPEPLPQPDFDDKGENLENIEPLQVSFAVLSSPNKSSISETLSGTDTFSSSN
420-490
NHEKISSPKVGRITRTSNRRNQLVSVVEESVCNLLNTEVQPCKEKKINRRKSQETKCTKRALPKKSQVLK
490-560
SCRKKKGKGKKSVQKSLYGERDIASKKPLLSPIPELPEVPEMTPSIPSIRRLGSGYFSSNGKLEEVKTPK
560-630
NPVKRKDLLRHDPDLHMHQGYDKYDVSEFCSYIKSSSSLGNATSDEDPNTNIMNINENKNIPKAKNKSES
630-700
ENEPKAGTDSPVSCASVTEERVASDSPKPALTLQQGQEFSAGGQNAENLCQFFKISPDLNIKCERKDDFL
700-770
GAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGR
770-840
SLHLEKNGNHTPSSSVGSSVEISLENSELFKDLSDAIEQTFQRRNSETKVRRSTRLQKDLENEGLVWISL
840-910
PLPSTSQKAKRRTICTFDSSGFESMSPIKETVSSRQKPQMAPPVSDPENSQGPAAGSSDEPGKRRKSFCI
910-980
STLANTKATSQFKGYRRRSSLNGKGESSLTALERIEHNGERKQ
980-1023
MDANSKDKPPETKESAMNNAGNASFILGTGKIVTPQKHAELPPNPCTPDTFKSPLNFSTVTVEQLGITPESFVRNSAGKSSSYLKKCRRRSAVGARGSPETNHLIRFIARQQNIKNARKSPLAQDSPSQGSPALYRNVNTLRERISAFQSAFHSIKENEKMTGCLEFSEAGKESEMTDLTRKEGLSACQQSGFPAVLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSSDAVSPDTFTAEVSSDAVPDVRSPATPACRRDLPTPKTFVLRSVLKKPSVKMCLESLQEHCNNLYDDDGTHPSLISNLPNCCKEKEAEDEENFEAPAFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTPVCKKDFSGLSSLLLEQSPVPEPLPQPDFDDKGENLENIEPLQVSFAVLSSPNKSSISETLSGTDTFSSSNNHEKISSPKVGRITRTSNRRNQLVSVVEESVCNLLNTEVQPCKEKKINRRKSQETKCTKRALPKKSQVLKSCRKKKGKGKKSVQKSLYGERDIASKKPLLSPIPELPEVPEMTPSIPSIRRLGSGYFSSNGKLEEVKTPKNPVKRKDLLRHDPDLHMHQGYDKYDVSEFCSYIKSSSSLGNATSDEDPNTNIMNINENKNIPKAKNKSESENEPKAGTDSPVSCASVTEERVASDSPKPALTLQQGQEFSAGGQNAENLCQFFKISPDLNIKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSSSVGSSVEISLENSELFKDLSDAIEQTFQRRNSETKVRRSTRLQKDLENEGLVWISLPLPSTSQKAKRRTICTFDSSGFESMSPIKETVSSRQKPQMAPPVSDPENSQGPAAGSSDEPGKRRKSFCISTLANTKATSQFKGYRRRSSLNGKGESSLTALERIEHNGERKQ