You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FRG2
Protein FRG2

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000378763
  • ENSP00000368039
  • ENSG00000205097
  • ENST00000504750
  • ENSP00000424015
  • ENST00000611713
  • ENSP00000482196
  • ENSG00000274972
  • ENST00000629452
  • ENSP00000485877
  • ENST00000644173
  • ENSP00000496323
  • ENSG00000285063
  • ENST00000645766
  • ENSP00000495315
  • ENST00000646140
  • ENSP00000494024
  • ENSG00000285202
  • ENST00000646368
  • ENSP00000494204

Symbol
  • FRG2A
  • FRG2A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.94
tissue
0.55
biological term
0.34
cell line
0.33
disease
0.32


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.89   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 3   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.89   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 3   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (1)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (19)
1 – 10 of 19
FRG1
Tbio
Novelty: 0.03780321
Score: 0.902
Data Source: STRINGDB
DUX4
Tbio
Novelty: 0.00987523
Score: 0.876
Data Source: STRINGDB
DUX4L7
Tdark
Novelty: 0.01119234
Score: 0.848
Data Source: STRINGDB
TNNT3
Tbio
Novelty: 0.0268478
Score: 0.64
Data Source: STRINGDB
MTMR1
Tbio
Family: Enzyme
Novelty: 0.11370255
Score: 0.627
Data Source: STRINGDB
SLC25A4
Tbio
Family: Transporter
Novelty: 0.01081101
Score: 0.579
Data Source: STRINGDB
FAM166A
Tdark
Score: 0.558
Data Source: STRINGDB
SMCHD1
Tbio
Novelty: 0.00627532
Score: 0.543
Data Source: STRINGDB
NCL
Tbio
Novelty: 0.00135718
Score: 0.527
Data Source: STRINGDB
KLKB1
Tclin
Family: Enzyme
Novelty: 0.00122934
Score: 0.499
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.89

PubMed score by year
PubTator Score  4.71

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGKGNEDSDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKEKGKTAFSHSSEKHIQRQGSEPNPNKENS
1-70
EETKLKAGNSTAGSEPESSSYRENCRKRKMSSKDSCQDTAGNCPEKECSLSLNKKSRSSTAVHNSEIQET
70-140
CDAHHRGHSRACTGHSKRHRSRALGVQTPSIRKSLVTSVRAMSEAVYQDLAQVWAQQIHSPLTCEQLTLL
140-210
TRLRGPLCAQVQTLYSMATQAAYVFPAESWLVPATLPGPGESALDREAHPFPGQEITETVSGSDEAKL
210-278
MGKGNEDSDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKEKGKTAFSHSSEKHIQRQGSEPNPNKENSEETKLKAGNSTAGSEPESSSYRENCRKRKMSSKDSCQDTAGNCPEKECSLSLNKKSRSSTAVHNSEIQETCDAHHRGHSRACTGHSKRHRSRALGVQTPSIRKSLVTSVRAMSEAVYQDLAQVWAQQIHSPLTCEQLTLLTRLRGPLCAQVQTLYSMATQAAYVFPAESWLVPATLPGPGESALDREAHPFPGQEITETVSGSDEAKL