You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
OTP
Homeobox protein orthopedia

Protein Summary
Description
Probably involved in the differentiation of hypothalamic neuroendocrine cells. This gene encodes a member of the homeodomain (HD) family. HD family proteins are helix-turn-helix transcription factors that play key roles in the specification of cell fates. This protein may function during brain development. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306422
  • ENSP00000302814
  • ENSG00000171540
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
biological process
0.63
PubMedID
0.56
chemical
0.45
tissue sample
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 171.18   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 127   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 171.18   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 127   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (57)
1 – 10 of 57
SIM1
Tbio
Family: TF
Novelty: 0.0105279
Score: 0.808
Data Source: STRINGDB
SIM2
Tbio
Novelty: 0.00421816
Score: 0.784
Data Source: STRINGDB
SIX3
Tbio
Family: TF
Novelty: 0.00299273
Score: 0.715
Data Source: STRINGDB
OXT
Tbio
Novelty: 0.00006195
Score: 0.705
Data Source: STRINGDB
FOXB1
Tbio
Family: TF
Novelty: 0.05960367
Score: 0.689
Data Source: STRINGDB
FEZF2
Tbio
Family: TF
Novelty: 0.0081868
Score: 0.671
Data Source: STRINGDB
ACTR1B
Tbio
Novelty: 0.15424927
Score: 0.65
Data Source: STRINGDB
TPH2
Tchem
Family: Enzyme
Novelty: 0.00306822
Score: 0.647
Data Source: STRINGDB
ACTR1A
Tbio
Novelty: 0.1045483
Score: 0.638
Data Source: STRINGDB
POU3F2
Tbio
Family: TF
Novelty: 0.00704703
Score: 0.632
Data Source: STRINGDB
Publication Statistics
PubMed Score  171.18

PubMed score by year
PubTator Score  39.34

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTP
1-70
ASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALR
70-140
IGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGDSLCSFHANDTRWA
140-210
AAAMPGVSQLPLPPALGRQQAMAQSLSQCSLAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPAS
210-280
LPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTVSMSFT
280-325
MLSHADLLDARLGMKDAAELLGHREAVKCRLGVGGSDPGGHPGDLAPNSDPVEGATLLPGEDITTVGSTPASLAVSAKDPDKQPGPQGGPNPSQAGQQQGQQKQKRHRTRFTPAQLNELERSFAKTHYPDIFMREELALRIGLTESRVQVWFQNRRAKWKKRKKTTNVFRAPGTLLPTPGLPQFPSAAAAAAAAMGDSLCSFHANDTRWAAAAMPGVSQLPLPPALGRQQAMAQSLSQCSLAAGPPPNSMGLSNSLAGSNGAGLQSHLYQPAFPGMVPASLPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTVSMSFT