You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KHDRBS2
KH domain-containing, RNA-binding, signal transduction-associated protein 2

Protein Summary
Description
RNA-binding protein that plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. Binds both poly(A) and poly(U) homopolymers. Phosphorylation by PTK6 inhibits its RNA-binding ability (By similarity). Induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. Can regulate alternative splicing of NRXN1 in the laminin G-like domain 6 containing the evolutionary conserved neurexin alternative spliced segment 4 (AS4) involved in neurexin selective targeting to postsynaptic partners. Regulates cell-type specific alternative splicing of NRXN1 at AS4 and acts synergystically with SAM68 in exon skipping. In contrast acts antagonistically with SAM68 in NRXN3 exon skipping at AS4. Its phosphorylation by FYN inhibits its ability to regulate splice site selection. May function as an adapter protein for Src kinases during mitosis.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000281156
  • ENSP00000281156
  • ENSG00000112232

Symbol
  • SLM1
  • SLM1
  • SLM-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.85
trait
0.75
cell line
0.63
molecular function
0.6
tissue sample
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.11   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 129   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 22.11   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 129   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
PTK6 Regulates Proteins Involved in RNA Processing (R-HSA-8849468)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
PTK6 Regulates Proteins Involved in RNA Processing
Reactome
Signal Transduction
Reactome
Signaling by Non-Receptor Tyrosine Kinases
Reactome
Signaling by PTK6
Name
Explore in Pharos
Explore in Source
PTK6 Regulates Proteins Involved in RNA Processing
Signal Transduction
Signaling by Non-Receptor Tyrosine Kinases
Signaling by PTK6
Gene Ontology Terms (9)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (103)
1 – 10 of 103
KHDRBS3
Tbio
Novelty: 0.00301036
p_int: 0.999999987
p_ni: 3e-9
p_wrong: 1.1e-8
Score: 0.792
Data Source: BioPlex,STRINGDB
FBXW11
Tbio
Novelty: 0.14703388
p_int: 0.999999519
p_ni: 4.81e-7
Score: 0.152
Data Source: BioPlex,STRINGDB
BTRC
Tbio
Novelty: 0.00393331
p_int: 0.999999164
p_ni: 8.36e-7
Data Source: BioPlex
ATG7
Tbio
Novelty: 0.00164436
p_int: 0.999963734
p_ni: 0.000036265
p_wrong: 1e-9
Score: 0.171
Data Source: BioPlex,STRINGDB
KHDRBS1
Tbio
Novelty: 0.00737623
p_int: 0.999935182
p_ni: 0.000064818
Score: 0.44
Data Source: BioPlex,STRINGDB
WDR45B
Tbio
Novelty: 0.52485612
p_int: 0.999894904
p_ni: 0.000105096
Data Source: BioPlex
YRDC
Tdark
Novelty: 0.01588082
p_int: 0.999863096
p_ni: 0.000136901
p_wrong: 2e-9
Score: 0.188
Data Source: BioPlex,STRINGDB
CRBN
Tclin
Novelty: 0.00385774
p_int: 0.999520777
p_ni: 0.000056255
p_wrong: 0.000422968
Data Source: BioPlex
PLCG1
Tchem
Family: Enzyme
Novelty: 0.00125418
p_int: 0.99878948
p_ni: 0.001210284
p_wrong: 2.36e-7
Score: 0.274
Data Source: BioPlex,STRINGDB
PTER
Tbio
Family: Enzyme
Novelty: 0.00098273
p_int: 0.998034605
p_ni: 0.001962663
p_wrong: 0.000002732
Score: 0.18
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  22.11

PubMed score by year
PubTator Score  9.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQ
1-70
YPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAP
70-140
PGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAI
140-210
PPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEY
210-280
DDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY
280-349
MEEEKYLPELMAEKDSLDPSFVHASRLLAEEIEKFQGSDGKKEDEEKKYLDVISNKNIKLSERVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKAKEEELRKSGEAKYAHLSDELHVLIEVFAPPGEAYSRMSHALEEIKKFLVPDYNDEIRQEQLRELSYLNGSEDSGRGRGIRGRGIRIAPTAPSRGRGGAIPPPPPPGRGVLTPRGSTVTRGALPVPPVARGVPTPRARGAPTVPGYRAPPPPAHEAYEEYGYDDGYGGEYDDQTYETYDNSYATQTQSVPEYYDYGHGVSEDAYDSYAPEEWATTRSSLKAPPQRSARGGYREHPYGRY