You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EMC10
ER membrane protein complex subunit 10

Protein Summary
Description
Promotes angiogenesis and tissue repair in the heart after myocardial infarction. Stimulates cardiac endothelial cell migration and outgrowth via the activation of p38 MAPK, PAK and MAPK2 signaling pathways.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000334976
  • ENSP00000334037
  • ENSG00000161671
  • ENST00000376918
  • ENSP00000366117

Symbol
  • C19orf63
  • HSM1
  • INM02
  • HSM1
  • HSS1
  • C19orf63
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.68
virus perturbation
0.64
transcription factor
0.63
disease perturbation
0.62
transcription factor binding site profile
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.02   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 65   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.02   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 65   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
22q11.2 Deletion Syndrome
WikiPathways
22q11.2 Deletion Syndrome
Name
Explore in Pharos
Explore in Source
22q11.2 Deletion Syndrome
22q11.2 Deletion Syndrome
22q11.2 Deletion Syndrome
Protein-Protein Interactions (54)
1 – 10 of 54
EMC9
Tdark
Novelty: 7
p_int: 0.999891768
p_ni: 0.000108231
p_wrong: 1e-9
Score: 0.998
Data Source: BioPlex,STRINGDB
EMC3
Tbio
Novelty: 0.01516701
p_int: 0.999853412
p_ni: 0.000146396
p_wrong: 1.93e-7
Score: 0.997
Data Source: BioPlex,STRINGDB
EMC6
Tbio
Novelty: 0.26086957
p_int: 0.999334382
p_ni: 0.000665617
p_wrong: 1e-9
Score: 0.98
Data Source: BioPlex,STRINGDB
EMC7
Tdark
Novelty: 1.28514589
p_int: 0.998966362
p_ni: 0.001033007
p_wrong: 6.31e-7
Score: 0.997
Data Source: BioPlex,STRINGDB
EMC2
Tbio
Novelty: 0.1393497
p_int: 0.998384283
p_ni: 0.001615001
p_wrong: 7.16e-7
Score: 0.994
Data Source: BioPlex,STRINGDB
TRDN
Tbio
Novelty: 0.00251509
p_int: 0.992461658
p_ni: 0.007310503
p_wrong: 0.00022784
Score: 0.719
Data Source: BioPlex,STRINGDB
MMGT1
Tdark
Novelty: 0.19354839
p_int: 0.990639876
p_ni: 0.009359988
p_wrong: 1.36e-7
Score: 0.994
Data Source: BioPlex,STRINGDB
SDF2L1
Tbio
Novelty: 0.23702262
p_int: 0.988992725
p_ni: 0.007173808
p_wrong: 0.003833467
Score: 0.238
Data Source: BioPlex,STRINGDB
EMC4
Tdark
Novelty: 0.23166023
p_int: 0.98329928
p_ni: 0.015063557
p_wrong: 0.001637163
Score: 0.968
Data Source: BioPlex,STRINGDB
SCGB1D1
Tbio
Novelty: 0.00676385
p_int: 0.983191241
p_ni: 0.015197027
p_wrong: 0.001611733
Data Source: BioPlex
Publication Statistics
PubMed Score  13.02

PubMed score by year
PubTator Score  8.63

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRK
1-70
RGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVES
70-140
HLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQA
140-210
QKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDTGGQGGGGGGGGGGGSGR
210-262
MAAASAGATRLLLLLLMAVAAPSRARGSGCRAGTGARGAGAEGREGEACGTVGLLLEHSFEIDDSANFRKRGSLLWNQQDGTLSLSQRQLSEEERGRLRDVAALNGLYRVRIPRRPGALDGLEAGGYVSSFVPACSLVESHLSDQLTLHVDVAGNVVGVSVVTHPGGCRGHEVEDVDLELFNTSVQLQPPTTAPGPETAAFIERLEMEQAQKAKNPQEQKSFFAKYWMYIIPVVLFLMMSGAPDTGGQGGGGGGGGGGGSGR