You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FHL5
Four and a half LIM domains protein 5

Protein Summary
Description
May be involved in the regulation of spermatogenesis. Stimulates CREM transcriptional activity in a phosphorylation-independent manner. The protein encoded by this gene is coordinately expressed with activator of cAMP-responsive element modulator (CREM). It is associated with CREM and confers a powerful transcriptional activation function. CREM acts as a transcription factor essential for the differentiation of spermatids into mature spermatozoa. There are multiple polyadenylation sites found in this gene. Polymorphisms in this gene may be associated with susceptibility for migraine headaches. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Apr 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000326771
  • ENSP00000326022
  • ENSG00000112214
  • ENST00000541107
  • ENSP00000442357

Symbol
  • ACT
  • ACT
  • FHL-5
  • dJ393D12.2
  • 1700027G07Rik
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.63
kinase perturbation
0.6
protein complex
0.57
gene perturbation
0.55
phenotype
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.43   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 146   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.43   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 146   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (5)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (35)
1 – 10 of 35
CEP76
Tdark
Novelty: 0.88669951
p_int: 0.999963572
p_ni: 0.000036365
p_wrong: 6.3e-8
Score: 0.21
Data Source: BioPlex,STRINGDB
TAX1BP1
Tbio
Novelty: 0.03179306
p_int: 0.999927893
p_ni: 0.000072107
Data Source: BioPlex
ZNF131
Tbio
Family: TF
Novelty: 0.19701589
p_int: 0.999881524
p_ni: 0.000068394
p_wrong: 0.000050083
Score: 0.799
Data Source: BioPlex,STRINGDB
ZMYM1
Tdark
p_int: 0.999794476
p_ni: 0.000205519
p_wrong: 5e-9
Score: 0.214
Data Source: BioPlex,STRINGDB
SCNM1
Tdark
Novelty: 0.24120603
p_int: 0.99936427
p_ni: 0.000635011
p_wrong: 7.19e-7
Data Source: BioPlex
ZMYM6
Tdark
Novelty: 2.35023041
p_int: 0.987083939
p_ni: 0.01291606
Data Source: BioPlex
PDLIM7
Tbio
Novelty: 0.00341895
p_int: 0.946659386
p_ni: 0.053340573
p_wrong: 4.1e-8
Score: 0.235
Data Source: BioPlex,STRINGDB
CTU1
Tbio
Novelty: 0.06213937
p_int: 0.840714837
p_ni: 0.159270305
p_wrong: 0.000014858
Data Source: BioPlex
CREM
Tbio
Family: TF
Novelty: 0.00090177
Score: 0.97
Data Source: STRINGDB
KIF17
Tbio
Novelty: 0.00761028
Score: 0.968
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.43

PubMed score by year
PubTator Score  10.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCT
1-70
KCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTK
70-140
PLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFC
140-210
VDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGM
210-280
DTDI
280-284
MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSGCRKDLCEEQFMSRDDYPFCVDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI