You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SYT6
Synaptotagmin-6

Protein Summary
Description
May be involved in Ca(2+)-dependent exocytosis of secretory vesicles through Ca(2+) and phospholipid binding to the C2 domain or may serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis. May mediate Ca(2+)-regulation of exocytosis in acrosomal reaction in sperm (By similarity). The protein encoded by this gene belongs to the synaptotagmin family. Synaptotagmins share a common domain structure that includes a transmembrane domain and a cytoplasmic region composed of 2 C2 domains, and are involved in calcium-dependent exocytosis of synaptic vesicles. This protein has been shown to be a key component of the secretory machinery involved in acrosomal exocytosis. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Dec 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369547
  • ENSP00000358560
  • ENSG00000134207
  • ENST00000607941
  • ENSP00000476507
  • ENST00000609117
  • ENSP00000477344
  • ENST00000610222
  • ENSP00000476396

Symbol
  • sytVI
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.84
cellular component
0.71
molecular function
0.7
cell line
0.65
gene perturbation
0.62


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.39   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 309   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13.39   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 309   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (25)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
BHF-UCL
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (79)
1 – 10 of 79
SYT3
Tbio
Novelty: 0.03816266
p_int: 0.999999999
p_ni: 1e-9
Score: 0.86
Data Source: BioPlex,STRINGDB
SYT10
Tbio
Novelty: 0.07565117
p_int: 0.999964911
p_ni: 9.7e-8
p_wrong: 0.000034992
Score: 0.9
Data Source: BioPlex,STRINGDB
AHCYL2
Tbio
Family: Enzyme
Novelty: 0.10791598
p_int: 0.940172066
p_ni: 0.059827934
Data Source: BioPlex
MADD
Tbio
Family: Enzyme
Novelty: 0.01721987
p_int: 0.937450516
p_ni: 0.062549484
Score: 0.822
Data Source: BioPlex,STRINGDB
SNAP25
Tclin
Novelty: 0.0020914
Score: 0.775
Data Source: STRINGDB
STX3
Tbio
Novelty: 0.01589793
Score: 0.699
Data Source: STRINGDB
VAMP2
Tbio
Novelty: 0.00274235
Score: 0.672
Data Source: STRINGDB
SNAP23
Tbio
Novelty: 0.00732279
Score: 0.671
Data Source: STRINGDB
STX1A
Tbio
Novelty: 0.00128938
Score: 0.655
Data Source: STRINGDB
CPLX1
Tbio
Novelty: 0.01111396
Score: 0.647
Data Source: STRINGDB
Publication Statistics
PubMed Score  13.39

PubMed score by year
PubTator Score  4.07

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSGVWGAGGPRCQEALAVLASLCRARPPPLGLDVETCRSFELQPPERSPSAAGAGTSVSLLAVVVIVCGV
1-70
ALVAVFLFLFWKLCWMPWRNKEASSPSSANPPLEALQSPSFRGNMADKLKDPSTLGFLEAAVKISHTSPD
70-140
IPAEVQMSVKEHIMRHTRLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAEQPTSIGRIKPE
140-210
LYKQKSVDGEDAKSEATKSCGKINFSLRYDYETETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCK
210-280
LQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWK
280-350
DIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIK
350-420
KNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPI
420-490
AHWHSLVEVKKSFKEGNPRL
490-510
MSGVWGAGGPRCQEALAVLASLCRARPPPLGLDVETCRSFELQPPERSPSAAGAGTSVSLLAVVVIVCGVALVAVFLFLFWKLCWMPWRNKEASSPSSANPPLEALQSPSFRGNMADKLKDPSTLGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTRLQRQTTEPASSTRHTSFKRHLPRQMHVSSVDYGNELPPAAEQPTSIGRIKPELYKQKSVDGEDAKSEATKSCGKINFSLRYDYETETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFHFPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSESVDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTIKKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGITAEGLGRDHWNEMLAYPRKPIAHWHSLVEVKKSFKEGNPRL