You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LCE1B
Late cornified envelope protein 1B

Protein Summary
Description
Precursors of the cornified envelope of the stratum corneum.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000360090
  • ENSP00000353203
  • ENSG00000196734

Symbol
  • LEP2
  • SPRL2A
  • LEP2
  • SPRL2A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue
0.68
cell line
0.45
biological term
0.33
tissue sample
0.32
protein domain
0.26


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.88   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 52   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 11.88   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 52   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Developmental Biology (R-HSA-1266738)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Developmental Biology
Reactome
Formation of the cornified envelope
Reactome
Keratinization
Name
Explore in Pharos
Explore in Source
Developmental Biology
Formation of the cornified envelope
Keratinization
Gene Ontology Terms (6)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (44)
1 – 10 of 44
LCE1A
Tbio
Novelty: 0.06809339
Score: 0.996
Data Source: STRINGDB
LCE1E
Tdark
Novelty: 2.1
Score: 0.994
Data Source: STRINGDB
LCE1D
Tbio
Novelty: 1.93103448
Score: 0.991
Data Source: STRINGDB
LCE3C
Tbio
Novelty: 0.06371067
Score: 0.988
Data Source: STRINGDB
LCE3B
Tbio
Novelty: 0.06681177
Score: 0.986
Data Source: STRINGDB
LCE2D
Tdark
Novelty: 3.07692308
Score: 0.982
Data Source: STRINGDB
LCE2B
Tdark
Novelty: 1.73333333
Score: 0.98
Data Source: STRINGDB
LCE1F
Tdark
Novelty: 0.65116279
Score: 0.974
Data Source: STRINGDB
LCE6A
Tdark
Novelty: 13
Score: 0.973
Data Source: STRINGDB
LCE2C
Tdark
Score: 0.968
Data Source: STRINGDB
Publication Statistics
PubMed Score  11.88

PubMed score by year
PubTator Score  10.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSS
1-70
GGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC
70-118
MSCQQNQQQCQPPPKCIPKCPPKCLTPRCPPKCPPKCPPVSSCCSVSSGGCCGSSSGGSCGSSSGGCCSSGGGGCCLSHHRRRRSHCHRPQSSGCCSQPSGGSSCCGGGSGQHSGGCC