You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
CFAP58
Cilia- and flagella-associated protein 58

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369704
  • ENSP00000358718
  • ENSG00000120051

Symbol
  • C10orf80
  • CCDC147
  • CCDC147
  • C10orf80
  • bA127L20.4
  • bA127L20.5
  • bA554P13.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.77
histone modification site profile
0.65
tissue sample
0.59
cell line
0.52
tissue
0.5


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.33   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 86   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.33   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 86   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (9)
1 – 9 of 9
CCDC40
Tbio
Novelty: 0.08874937
Score: 0.632
Data Source: STRINGDB
CBFA2T2
Tbio
Novelty: 0.07078453
Score: 0.626
Data Source: STRINGDB
DYNC2LI1
Tbio
Novelty: 0.09788315
Score: 0.553
Data Source: STRINGDB
ZNF326
Tbio
Novelty: 0.26059979
Score: 0.549
Data Source: STRINGDB
DNAI2
Tbio
Novelty: 0.04401314
Score: 0.511
Data Source: STRINGDB
C1orf100
Tdark
Novelty: 0.68965517
Score: 0.473
Data Source: STRINGDB
POT1
Tbio
Novelty: 0.01479724
Score: 0.468
Data Source: STRINGDB
HSF5
Tbio
Family: TF
Novelty: 0.03540626
Score: 0.452
Data Source: STRINGDB
CCDC146
Tdark
Novelty: 1.42465753
Score: 0.444
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.33

PubMed score by year
PubTator Score  0.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAEEKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAE
1-70
IVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGL
70-140
SMDQHSNIRDLLRFKEEVTKERDQLLSEVVKLRESLAQTTEQQQETERSKEEAEHAISQFQQEIQQRQNE
140-210
ASREFRKKEKLEKELKQIQADMDSRQTEIKALQQYVQKSKEELQKLEQQLKEQKILNERAAKELEQFQMR
210-280
NAKLQQENEQHSLVCEQLSQENQQKALELKAKEEEVHQMRLDIGKLNKIREQIHKKLHHTEDQKAEVEQH
280-350
KETLKNQIVGLEREVEASKKQAELDRKAMDELLRERDILNKNMLKAVNATQKQTDLVKLHEQAKRNLEGE
350-420
IQNYKDEAQKQRKIIFHLEKERDRYINQASDLTQKVLMNMEDIKVRETQIFDYRKKIAESEIKLKQQQNL
420-490
YEAVRSDRNLYSKNLVEAQDEITDMKRKLKIMIHQVDELKEDISAKESALVKLHLEQQRIEKEKETLKAE
490-560
LQKLRQQALETKHFIEKQEAEERKLLRIIAEADGERLRQKKELDQVISERDILGSQLVRRNDELALLYEK
560-630
IKIQQSVLNKGESQYNQRLEDMRILRLEIKKLRREKGILARSMANVEELRQEFFHMQRELLKERTRCRAL
630-700
EEELENPLNVHRWRKLEASDPNAYELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYMELKHVLARQPG
700-770
PEAAEQLKLYRRTLHDKKQQLKVLSSELNMYEVQSKEYKYEVEKLTNELQNLKKKYLAQKRKEQLQKNKD
770-840
TAPMDNTFLMVKPNGPGFTGGGFPLRSTKMTF
840-872
MAEEKGGKQVLEESAFEEMERDFQGVLHELSGDKSLEKFRIEYERLHAVMKKSYDNEKRLMAKCRELNAEIVVNSAKVATALKLSQDDQTTIASLKKEIEKAWKMVDSAYDKEQKAKETILALKEEIVNLTKLVEQGSGLSMDQHSNIRDLLRFKEEVTKERDQLLSEVVKLRESLAQTTEQQQETERSKEEAEHAISQFQQEIQQRQNEASREFRKKEKLEKELKQIQADMDSRQTEIKALQQYVQKSKEELQKLEQQLKEQKILNERAAKELEQFQMRNAKLQQENEQHSLVCEQLSQENQQKALELKAKEEEVHQMRLDIGKLNKIREQIHKKLHHTEDQKAEVEQHKETLKNQIVGLEREVEASKKQAELDRKAMDELLRERDILNKNMLKAVNATQKQTDLVKLHEQAKRNLEGEIQNYKDEAQKQRKIIFHLEKERDRYINQASDLTQKVLMNMEDIKVRETQIFDYRKKIAESEIKLKQQQNLYEAVRSDRNLYSKNLVEAQDEITDMKRKLKIMIHQVDELKEDISAKESALVKLHLEQQRIEKEKETLKAELQKLRQQALETKHFIEKQEAEERKLLRIIAEADGERLRQKKELDQVISERDILGSQLVRRNDELALLYEKIKIQQSVLNKGESQYNQRLEDMRILRLEIKKLRREKGILARSMANVEELRQEFFHMQRELLKERTRCRALEEELENPLNVHRWRKLEASDPNAYELIQKIHTLQKRLISKTEEVVEKELLLQEKEKLYMELKHVLARQPGPEAAEQLKLYRRTLHDKKQQLKVLSSELNMYEVQSKEYKYEVEKLTNELQNLKKKYLAQKRKEQLQKNKDTAPMDNTFLMVKPNGPGFTGGGFPLRSTKMTF