You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CCNJ
Cyclin-J

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000265992
  • ENSP00000265992
  • ENSG00000107443
  • ENST00000403870
  • ENSP00000384498
  • ENST00000465148
  • ENSP00000435373

Symbol
  • bA690P14.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.71
virus perturbation
0.68
histone modification site profile
0.65
protein domain
0.58
transcription factor binding site profile
0.53


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.26   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 135   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.26   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 135   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (20)
1 – 10 of 20
GORASP1
Tbio
Novelty: 0.0271696
p_int: 0.999940687
p_wrong: 0.000059312
Score: 0.158
Data Source: BioPlex,STRINGDB
POTEF
Tbio
Novelty: 0.01093698
p_int: 0.99834741
p_ni: 0.00165259
Score: 0.179
Data Source: BioPlex,STRINGDB
SPECC1L
Tbio
Novelty: 0.12603151
p_int: 0.794737781
p_ni: 0.205262219
Score: 0.187
Data Source: BioPlex,STRINGDB
MEGF9
Tdark
Novelty: 0.69250992
Score: 0.732
Data Source: STRINGDB
NAGA
Tbio
Family: Enzyme
Novelty: 0.00628096
Score: 0.682
Data Source: STRINGDB
FSHR
Tclin
Family: GPCR
Novelty: 0.00142021
Score: 0.636
Data Source: STRINGDB
CDO1
Tbio
Family: Enzyme
Novelty: 0.02161596
Score: 0.625
Data Source: STRINGDB
MKNK1
Tchem
Family: Kinase
Novelty: 0.01723237
Score: 0.575
Data Source: STRINGDB
GLA
Tclin
Family: Enzyme
Novelty: 0.0006641
Score: 0.526
Data Source: STRINGDB
ENPEP
Tchem
Family: Enzyme
Novelty: 0.00116769
Score: 0.513
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.26

PubMed score by year
PubTator Score  3.04

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDL
1-70
FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQW
70-140
NLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSP
140-210
TWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYL
210-280
HQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLS
280-350
VSYNRSYQINEHYPCITPCFER
350-372
MELEGQWWRGQLAADIHQALRYKELKLPSYKGQSPQLSLRRYFADLIAIVSNRFTLCPSARHLAVYLLDLFMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNLVLTKQNLLHMELLLLETFQWNLCLPTAAHFIEYYLSEAVHETDLHDGWPMICLEKTKLYMAKYADYFLEVSLQVAAACVASSRIILRLSPTWPTRLHRLTAYSWDFLVQCIERLLIAHDNDVKEANKQRGQAGPQSAQLSVFQTASQPSRPVHFQQPQYLHQTHQTSLQYRHPTSEQPSCQQIVSTTHTSSYTLQTCPAGFQTSVQGLGHMQTGVGMSLAIPVEVKPCLSVSYNRSYQINEHYPCITPCFER