You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
C10orf120
Uncharacterized protein C10orf120

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000329446
  • ENSP00000331012
  • ENSG00000183559

Symbol
  • bA318C4.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 24   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 24   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (10)
1 – 10 of 10
HAL
Tbio
Family: Enzyme
Novelty: 0.00925623
p_int: 0.908112096
p_ni: 0.091887898
p_wrong: 6e-9
Data Source: BioPlex
ENHO
Tbio
Novelty: 0.01185403
Score: 0.784
Data Source: STRINGDB
HDHD3
Tdark
Family: Enzyme
Novelty: 2.25
Score: 0.669
Data Source: STRINGDB
ATP8B4
Tdark
Family: Transporter
Novelty: 0.29546254
Score: 0.585
Data Source: STRINGDB
GFRA4
Tbio
Novelty: 0.25334272
Score: 0.58
Data Source: STRINGDB
PLA2G4E
Tbio
Family: Enzyme
Novelty: 0.29946201
Score: 0.56
Data Source: STRINGDB
GANC
Tchem
Family: Enzyme
Novelty: 0.02762131
Score: 0.537
Data Source: STRINGDB
RUNX1T1
Tbio
Novelty: 0.00144196
Score: 0.519
Data Source: STRINGDB
MXD3
Tbio
Family: TF
Novelty: 0.0079582
Score: 0.479
Data Source: STRINGDB
BMP3
Tbio
Novelty: 0.00762549
Score: 0.442
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MIREWKNDCQRIEKQRASDTMVQERKNEKPVRIFNTNSSFQDQAPTCCQEDLSSASPLRIWSKFYRSDPR
1-70
IALGKYSPLEKEILRLGGIHTIAARRLLAYKQEEECRMLKELQLLSPDYKQAMEYKKKHSSPCAICVPLE
70-140
KIWTAKVIAPLEAFKMPQREQVNVSKHIERMRLARALGNHQPLPYIERFTRSSFLSGVGLGPMAKNKARR
140-210
KEDNYDTHNCDDANQDKKEEAEGKNTKRREIKMNVVFKSKEPKKCLTYHGNDRKSFLPAKKPERSIAGLT
210-280
NRNLFCISEFPGDLMLMNQDFISRRDHFSDLVKTYSLEEESIWKERMRKATPYHY
280-335
MIREWKNDCQRIEKQRASDTMVQERKNEKPVRIFNTNSSFQDQAPTCCQEDLSSASPLRIWSKFYRSDPRIALGKYSPLEKEILRLGGIHTIAARRLLAYKQEEECRMLKELQLLSPDYKQAMEYKKKHSSPCAICVPLEKIWTAKVIAPLEAFKMPQREQVNVSKHIERMRLARALGNHQPLPYIERFTRSSFLSGVGLGPMAKNKARRKEDNYDTHNCDDANQDKKEEAEGKNTKRREIKMNVVFKSKEPKKCLTYHGNDRKSFLPAKKPERSIAGLTNRNLFCISEFPGDLMLMNQDFISRRDHFSDLVKTYSLEEESIWKERMRKATPYHY