You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
ANKRD20A2
Ankyrin repeat domain-containing protein 20A2

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000377601
  • ENSP00000366826
  • ENSG00000183148
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.81
cell line
0.59
tissue
0.37
protein domain
0.26
transcription factor
0.22


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.13   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 3   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0.13   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 3   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (26)
1 – 10 of 26
FOXD4L5
Tdark
Family: TF
Novelty: 7
Score: 0.72
Data Source: STRINGDB
CBWD6
Tdark
Score: 0.706
Data Source: STRINGDB
FOXD4L3
Tdark
Family: TF
Novelty: 3.00977199
Score: 0.684
Data Source: STRINGDB
FAM72C
Tdark
Score: 0.673
Data Source: STRINGDB
ZNF492
Tdark
Family: TF
Novelty: 1.2
Score: 0.672
Data Source: STRINGDB
FAM182B
Tdark
Novelty: 4
Score: 0.644
Data Source: STRINGDB
FAM72D
Tdark
Novelty: 1.71428571
Score: 0.633
Data Source: STRINGDB
NBPF19
Tdark
Novelty: 1.98113208
Score: 0.63
Data Source: STRINGDB
FAM72B
Tdark
Novelty: 4.23529412
Score: 0.629
Data Source: STRINGDB
ZNF595
Tdark
Novelty: 2.68623025
Score: 0.596
Data Source: STRINGDB
Publication Statistics
PubMed Score  0.13

PubMed score by year
PubTator Score  0.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLFGFGSRRGQTAQGSIDHVYTGSGYRIRDSELQKIHRAAVKGDAAEVERCLARRSGDLDALDKQHRTA
1-70
LHLACASGHVQVVTLLVNRKCQIDVCDKENRTPLIQAVHCQEEACAVILLEHGANPNLKDIYGNTALHYA
70-140
VYSESTSLAEKLLSHGAHIEALDKDNNTPLLFAIICKKEKMVEFLLKRKASSHAVDRLRRSALMLAVYYD
140-210
SPGIVNILLKQNIDVFAQDMCGRDAEDYAISHHLTKIQQQILEHKKKILKKEKSDVGSSDESAVSIFHEL
210-280
RVDSLPASDDKDLNVATKQCVPEKVSEPLPGSSHEKGNRIVNGQGEGPPAKHPSLKPSTEVEDPAVKGAV
280-350
QRKNVQTLRAEQALPVASEEEQERHERSEKKQPQVKEGNNTNKSEKIQLSENICDSTSSAAAGRLTQQRK
350-420
IGKTYPQQFPKKLKEEHDRCTLKQENEEKTNVNMLYKKNREELERKEKQYKKEVEAKQLEPTVQSLEMKS
420-490
KTARNTPNRDFHNHEEMKGLMDENCILKADIAILRQEICTMKNDNLEKENKYLKDIKIVKETNAALEKYI
490-560
KLNEEMITETAFRYQQELNDLKAENTRLNAELLKEKESKKRLEADIESYQSRLAAAISKHSESVKTERNL
560-630
KLALERTRDVSVQVEMSSAISKVKDENEFLTEQLSETQIKFNALKDKFRKTRDSLRKKSLALETVQNDLS
630-700
QTQQQTQEMKEMYQNAEAKVNNSTGKWNCVEERICHLQRENAWLVQQLDDVHQKEDHKEIVTNIQRGFIE
700-770
SGKKDLVLEEKSKKLMNECDHLKESLFQYEREKTEGVVSIKEDKYFQTSRKKI
770-823
MKLFGFGSRRGQTAQGSIDHVYTGSGYRIRDSELQKIHRAAVKGDAAEVERCLARRSGDLDALDKQHRTALHLACASGHVQVVTLLVNRKCQIDVCDKENRTPLIQAVHCQEEACAVILLEHGANPNLKDIYGNTALHYAVYSESTSLAEKLLSHGAHIEALDKDNNTPLLFAIICKKEKMVEFLLKRKASSHAVDRLRRSALMLAVYYDSPGIVNILLKQNIDVFAQDMCGRDAEDYAISHHLTKIQQQILEHKKKILKKEKSDVGSSDESAVSIFHELRVDSLPASDDKDLNVATKQCVPEKVSEPLPGSSHEKGNRIVNGQGEGPPAKHPSLKPSTEVEDPAVKGAVQRKNVQTLRAEQALPVASEEEQERHERSEKKQPQVKEGNNTNKSEKIQLSENICDSTSSAAAGRLTQQRKIGKTYPQQFPKKLKEEHDRCTLKQENEEKTNVNMLYKKNREELERKEKQYKKEVEAKQLEPTVQSLEMKSKTARNTPNRDFHNHEEMKGLMDENCILKADIAILRQEICTMKNDNLEKENKYLKDIKIVKETNAALEKYIKLNEEMITETAFRYQQELNDLKAENTRLNAELLKEKESKKRLEADIESYQSRLAAAISKHSESVKTERNLKLALERTRDVSVQVEMSSAISKVKDENEFLTEQLSETQIKFNALKDKFRKTRDSLRKKSLALETVQNDLSQTQQQTQEMKEMYQNAEAKVNNSTGKWNCVEERICHLQRENAWLVQQLDDVHQKEDHKEIVTNIQRGFIESGKKDLVLEEKSKKLMNECDHLKESLFQYEREKTEGVVSIKEDKYFQTSRKKI