You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
FRMPD3
FERM and PDZ domain-containing protein 3

Protein Summary
Description
This gene encodes a protein that contains a PDZ (post synaptic density protein (PSD95), Drosophila disc large tumor suppressor (Dlg1), and zonula occludens-1 protein (zo-1) domain at the N-terminus followed by a FERM domain. The encoded protein is involved in signal transduction. The PDZ domain is thought to function in protein-protein interactions, mainly by binding to specific C-terminal peptides of other proteins. The FERM domain is found in proteins that are localized to the plasma membrane and are associated with the cytoskeleton. [provided by RefSeq, May 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000276185
  • ENSP00000276185
  • ENSG00000147234

Symbol
  • KIAA1817
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.73
cell line
0.6
tissue sample
0.55
protein complex
0.46
interacting protein
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 42   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 42   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Immune System (R-HSA-168256)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Immune System
Innate Immune System
Neutrophil degranulation
Protein-Protein Interactions (108)
1 – 10 of 108
NRAS
Tchem
Family: Enzyme
Novelty: 0.00085585
Score: 0.931
Data Source: STRINGDB
RAP2B
Tbio
Family: Enzyme
Novelty: 0.00404787
Score: 0.915
Data Source: STRINGDB
RAP2C
Tbio
Family: Enzyme
Novelty: 0.19402525
Score: 0.915
Data Source: STRINGDB
RAB14
Tbio
Family: Enzyme
Novelty: 0.02797855
Score: 0.909
Data Source: STRINGDB
SNAP25
Tclin
Novelty: 0.0020914
Score: 0.907
Data Source: STRINGDB
LILRB2
Tbio
Novelty: 0.00812824
Score: 0.905
Data Source: STRINGDB
KCNAB2
Tbio
Family: IC
Novelty: 0.02072106
Score: 0.902
Data Source: STRINGDB
TRPM2
Tchem
Family: IC
Novelty: 0.00902127
Score: 0.902
Data Source: STRINGDB
ANO6
Tbio
Family: IC
Novelty: 0.01570866
Score: 0.902
Data Source: STRINGDB
VAMP8
Tbio
Novelty: 0.01382646
Score: 0.902
Data Source: STRINGDB
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
METLDSQRVQDRLLAAPGCSSPSGQQELFSSHVMQEESANDMECEQLPAEILRQVTVHRDPIYGFGFVAG
1-70
SERPVVVRSVRPGGPSENKLLAGDQIVAINEEDVSEAPRERLIELIRSAKEFIVLTVLHTHQSPKSAFIS
70-140
AAKKAKLRSNPVKVRFSEQVAVGETDAKMMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMLTLQ
140-210
DRLSLRFIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAA
210-280
FEYLYIQSRNDVIRERFGMDPKPEMLLGLAALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQVI
280-350
KEKNLRKSLSQQLKAHQTHPSCGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLDEKQSATTLLVGPRH
350-420
GISHVIDLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLMEWPEATNFACLIAGYCRLL
420-490
LDSRKMVFSRPASQPLPPPMIKADYMHSAHRPVTGGHLGKKESSYVGSVGTSPRKSSRCTPPPADSELVS
490-560
FCYLHMREQRKEQESRTDVNENLIFFEETRPRTKSDPTSKSSGQGYEVVPDDFDAASLDHEPCASRARSY
560-630
TLDNSLGAEALNFYCDSCKAKLQEQLGPRKGGKPGSSRDNIVDLMSLPPPGSEEEEEEEDETTSLLPAIA
630-700
APPPGFRDNSSDEDDPKRRAVQSQEQGRHLRGLLYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQALE
700-770
ALAASEDGPHPPPPQTAGLIVLATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFLAQHLNKDS
770-840
LLARKDLPFRIQSCAAQAVLTAPYSLGRPDPNPSLQPIATGQSPGPPGARRKLPQSEGQVQGERTYSLAV
840-910
HPALSPQLSEQKNLSLLSPVPEDKGPGHTRAGLEMSLRAATSSLSEEQVSELRDNLPKEVRLSPKLILDP
910-980
KSSVTPAIISAALQQVVHNKSLVTAGGALGNPPSRGERRLEASMGRPEVSMMSSSASKNLKFKISPSAPE
980-1050
TSWNSQHQLGAEVSSSPRAPTGSRADSLHLSQQEDSLPVQNFPPKSYLLRTSRESVGKQATGEVAGKGGP
1050-1120
VGGKPTLQKQGTISSQGEKAQLESTPKRSKLEETSLVPRATYPMALQSPSCQSRSHSPSCQPHGHSPSSQ
1120-1190
SRGQSPSCQPRGQSPLRSQAASRQVSTMPSRKLETTLNGAHSTSEGPAKPKSSRGPFRLRNLFSATFPTR
1190-1260
QKKETDERQAQLQKVKQYELEFLEELLKPPSQGELPGTEYLQPPAPGRCSCQLRSSPVQQGPGMSREQRR
1260-1330
SCDCKRICRGGRPQATQTPVPSLRGRERDRVLPSQRQPEAGPGVSLSSPINVQRIRSTSLESRECRSDPE
1330-1400
SGVSCLTTCASGGECLGAPNYRKLMRRYSISELDQGDRASLTSDVYPHPPLGMLPREAKEVEASLPIALG
1400-1470
PKSRSLESPTLGDPSYVQVAPETKGPRQMAVFSLPEEVYRKPAELDEDSESSKCCSIRYCFYYRKCDMAD
1470-1540
DASDGKDELSYSIPMKILPGMKLDEQVVPVVSRTLQVLDAATCSSSSPEASRTQEIDLRVSTFEGSLAKI
1540-1610
NALRAHAYGLPDGFLAARLDTNELLTVLRQCVASPEARAPKPYVSQISEYKLELALKFKELRASCRRVAN
1610-1680
VDKSPTHMLAAITGSFQVLSSLIETFVRLVFIVRSEAQRQELLAKVEEVVRNYTFLLRAAEESTARNLNQ
1680-1750
QQQQQQQQQQQQQQQQQQQQQQQQQQVAAAAGAATEHPPGSPTSATVMSTFTHSLKTLIK
1750-1810
METLDSQRVQDRLLAAPGCSSPSGQQELFSSHVMQEESANDMECEQLPAEILRQVTVHRDPIYGFGFVAGSERPVVVRSVRPGGPSENKLLAGDQIVAINEEDVSEAPRERLIELIRSAKEFIVLTVLHTHQSPKSAFISAAKKAKLRSNPVKVRFSEQVAVGETDAKMMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMLTLQDRLSLRFIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQSRNDVIRERFGMDPKPEMLLGLAALHIYITVSATRPSQKISLKNVEKEWGLEPFLPPSLLQVIKEKNLRKSLSQQLKAHQTHPSCGTKGSAIQAKLQYLRILNELPTFTGVLFNTVGLDEKQSATTLLVGPRHGISHVIDLKTNLTTVLSEFSKISKIQLFRENQGVARVETSIMDAKPLVLLMEWPEATNFACLIAGYCRLLLDSRKMVFSRPASQPLPPPMIKADYMHSAHRPVTGGHLGKKESSYVGSVGTSPRKSSRCTPPPADSELVSFCYLHMREQRKEQESRTDVNENLIFFEETRPRTKSDPTSKSSGQGYEVVPDDFDAASLDHEPCASRARSYTLDNSLGAEALNFYCDSCKAKLQEQLGPRKGGKPGSSRDNIVDLMSLPPPGSEEEEEEEDETTSLLPAIAAPPPGFRDNSSDEDDPKRRAVQSQEQGRHLRGLLYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQALEALAASEDGPHPPPPQTAGLIVLATITPESSLDSGHETNSSELTDMSEMMSAMKQHQNTTYFLAQHLNKDSLLARKDLPFRIQSCAAQAVLTAPYSLGRPDPNPSLQPIATGQSPGPPGARRKLPQSEGQVQGERTYSLAVHPALSPQLSEQKNLSLLSPVPEDKGPGHTRAGLEMSLRAATSSLSEEQVSELRDNLPKEVRLSPKLILDPKSSVTPAIISAALQQVVHNKSLVTAGGALGNPPSRGERRLEASMGRPEVSMMSSSASKNLKFKISPSAPETSWNSQHQLGAEVSSSPRAPTGSRADSLHLSQQEDSLPVQNFPPKSYLLRTSRESVGKQATGEVAGKGGPVGGKPTLQKQGTISSQGEKAQLESTPKRSKLEETSLVPRATYPMALQSPSCQSRSHSPSCQPHGHSPSSQSRGQSPSCQPRGQSPLRSQAASRQVSTMPSRKLETTLNGAHSTSEGPAKPKSSRGPFRLRNLFSATFPTRQKKETDERQAQLQKVKQYELEFLEELLKPPSQGELPGTEYLQPPAPGRCSCQLRSSPVQQGPGMSREQRRSCDCKRICRGGRPQATQTPVPSLRGRERDRVLPSQRQPEAGPGVSLSSPINVQRIRSTSLESRECRSDPESGVSCLTTCASGGECLGAPNYRKLMRRYSISELDQGDRASLTSDVYPHPPLGMLPREAKEVEASLPIALGPKSRSLESPTLGDPSYVQVAPETKGPRQMAVFSLPEEVYRKPAELDEDSESSKCCSIRYCFYYRKCDMADDASDGKDELSYSIPMKILPGMKLDEQVVPVVSRTLQVLDAATCSSSSPEASRTQEIDLRVSTFEGSLAKINALRAHAYGLPDGFLAARLDTNELLTVLRQCVASPEARAPKPYVSQISEYKLELALKFKELRASCRRVANVDKSPTHMLAAITGSFQVLSSLIETFVRLVFIVRSEAQRQELLAKVEEVVRNYTFLLRAAEESTARNLNQQQQQQQQQQQQQQQQQQQQQQQQQQQVAAAAGAATEHPPGSPTSATVMSTFTHSLKTLIK