You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TCTE1
Dynein regulatory complex subunit 5

Protein Summary
Description
Component of the nexin-dynein regulatory complex (N-DRC) a key regulator of ciliary/flagellar motility which maintains the alignment and integrity of the distal axoneme and regulates microtubule sliding in motile axonemes. May play a role in the assembly of N-DRC. May be required for sperm motility.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371505
  • ENSP00000360560
  • ENSG00000146221

Symbol
  • DRC5
  • DRC5
  • D6S46
  • FAP155
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.68
cell type or tissue
0.6
cell line
0.55
tissue
0.55
PubMedID
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.56   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 66   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.56   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 66   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (75)
1 – 10 of 75
TCP10
Tbio
Novelty: 0.07819409
Score: 0.718
Data Source: STRINGDB
IQCA1
Tbio
Novelty: 0.15625
Score: 0.717
Data Source: STRINGDB
TCTE3
Tdark
Novelty: 0.1998141
Score: 0.711
Data Source: STRINGDB
MED6
Tbio
Family: Enzyme
Novelty: 0.07496272
Score: 0.706
Data Source: STRINGDB
ADGRL1
Tbio
Family: GPCR
Novelty: 0.01343585
Score: 0.685
Data Source: STRINGDB
ADGRL2
Tbio
Family: GPCR
Novelty: 0.01111728
Score: 0.685
Data Source: STRINGDB
ADGRL3
Tbio
Family: GPCR
Novelty: 0.00182297
Score: 0.685
Data Source: STRINGDB
DRC7
Tdark
Novelty: 1.66666667
Score: 0.68
Data Source: STRINGDB
GAS8
Tbio
Novelty: 0.04890704
Score: 0.677
Data Source: STRINGDB
CCDC65
Tdark
Novelty: 0.10161663
Score: 0.676
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.56

PubMed score by year
PubTator Score  4.22

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQDTVTTSALLDPSHSSVSTQDNSSTGGHTSSTSPQLSKPSITPVPAKSRNPHPRANIRRMRRIIAEDPE
1-70
WSLAIVPLLTELCIQHIIRNFQKNPILKQMLPEHQQKVLNHLSPDLPLAVTANLIDSENYWLRCCMHRWP
70-140
VCHVAHHGGSWKRMFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQLPAQLRPGD
140-210
QSDSGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMNFEWNLFLFTYRDCLSLAAAIKACHT
210-280
LKIFKLTRSKVDDDKARIIIRSLLDHPVLEELDLSQNLIGDRGARGAAKLLSHSRLRVLNLANNQVRAPG
280-350
AQSLAHALAHNTNLISLNLRLNCIEDEGGQALAHALQTNKCLTTLHLGGNELSEPTATLLSQVLAINTTL
350-420
TSINLSCNHIGLDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALYANREAARQRALNPSHFMST
420-490
ITANGPENSVG
490-501
MQDTVTTSALLDPSHSSVSTQDNSSTGGHTSSTSPQLSKPSITPVPAKSRNPHPRANIRRMRRIIAEDPEWSLAIVPLLTELCIQHIIRNFQKNPILKQMLPEHQQKVLNHLSPDLPLAVTANLIDSENYWLRCCMHRWPVCHVAHHGGSWKRMFFERHLENLLKHFIPGTTDPAVILDLLPLCRNYVRRVHVDQFLPPVQLPAQLRPGDQSDSGSEGEMEEPTVDHYQLGDLVAGLSHLEELDLVYDVKDCGMNFEWNLFLFTYRDCLSLAAAIKACHTLKIFKLTRSKVDDDKARIIIRSLLDHPVLEELDLSQNLIGDRGARGAAKLLSHSRLRVLNLANNQVRAPGAQSLAHALAHNTNLISLNLRLNCIEDEGGQALAHALQTNKCLTTLHLGGNELSEPTATLLSQVLAINTTLTSINLSCNHIGLDGGKQLLEGMSDNKTLLEFDLRLSDVAQESEYLIGQALYANREAARQRALNPSHFMSTITANGPENSVG