You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ZNF326
DBIRD complex subunit ZNF326

Protein Summary
Description
Core component of the DBIRD complex, a multiprotein complex that acts at the interface between core mRNP particles and RNA polymerase II (RNAPII) and integrates transcript elongation with the regulation of alternative splicing: the DBIRD complex affects local transcript elongation rates and alternative splicing of a large set of exons embedded in (A + T)-rich DNA regions. May play a role in neuronal differentiation and is able to bind DNA and activate expression in vitro.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000340281
  • ENSP00000340796
  • ENSG00000162664
  • ENST00000361911
  • ENSP00000355318

Symbol
  • ZIRD
  • ZIRD
  • ZAN75
  • Zfp326
  • dJ871E2.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.99
ligand (protein) perturbation
0.99
molecular function
0.76
virus perturbation
0.76
transcription factor binding site profile
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.52   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 133   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.52   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 133   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (12)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (62)
1 – 10 of 62
ELAVL2
Tbio
Novelty: 0.0071859
p_int: 0.954548322
p_ni: 0.045451678
Score: 0.517
Data Source: BioPlex,STRINGDB
APOBEC3D
Tbio
Novelty: 0.02451843
p_int: 0.868630094
p_ni: 0.131369906
Score: 0.564
Data Source: BioPlex,STRINGDB
LARP4B
Tbio
Novelty: 0.153294
p_int: 0.841727228
p_ni: 0.158272772
Data Source: BioPlex
MAP7
Tbio
Novelty: 0.02738196
p_int: 0.75809031
p_ni: 0.24190969
Data Source: BioPlex
CCAR2
Tbio
Novelty: 0.02010626
Score: 0.951
Data Source: STRINGDB
HNRNPA1
Tchem
Novelty: 0.00262355
Score: 0.745
Data Source: STRINGDB
HNRNPM
Tbio
Novelty: 0.01865149
Score: 0.716
Data Source: STRINGDB
MATR3
Tbio
Novelty: 0.01491794
Score: 0.713
Data Source: STRINGDB
HNRNPH1
Tbio
Novelty: 0.01807307
Score: 0.697
Data Source: STRINGDB
HNRNPC
Tbio
Novelty: 0.00195495
Score: 0.662
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.52

PubMed score by year
PubTator Score  2.75

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDFEDDYTHSACRNTYQGFNGMDRDYGPGSYGGMDRDYGHGSYGGQRSMDSYLNQSYGMDNHSGGGGGSR
1-70
FGPYESYDSRSSLGGRDLYRSGYGFNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSK
70-140
LRPGFMEDRGRENYSSYSSFSSPHMKPAPVGSRGRGTPAYPESTFGSRNYDAFGGPSTGRGRGRGHMGDF
140-210
GSIHRPGIVVDYQNKSTNVTVAAARGIKRKMMQPFNKPSGTFIKKPKLAKPMEKISLSKSPTKTDPKNEE
210-280
EEKRRIEARREKQRRRREKNSEKYGDGYRMAFTCSFCKFRTFEEKDIELHLESSSHQETLDHIQKQTKFD
280-350
KVVMEFLHECMVNKFKKTSIRKQQTNNQTEVVKIIEKDVMEGVTVDDHMMKVETVHCSACSVYIPALHSS
350-420
VQQHLKSPDHIKGKQAYKEQIKRESVLTATSILNNPIVKARYERFVKGENPFEIQDHSQDQQIEGDEEDE
420-490
EKIDEPIEEEEDEDEEEEAEEVGEVEEVEEVEEVREGGIEGEGNIQGVGEGGEVGVVGEVEGVGEVEEVE
490-560
ELEEETAKEEPADFPVEQPEEN
560-582
MDFEDDYTHSACRNTYQGFNGMDRDYGPGSYGGMDRDYGHGSYGGQRSMDSYLNQSYGMDNHSGGGGGSRFGPYESYDSRSSLGGRDLYRSGYGFNEPEQSRFGGSYGGRFESSYRNSLDSFGGRNQGGSSWEAPYSRSKLRPGFMEDRGRENYSSYSSFSSPHMKPAPVGSRGRGTPAYPESTFGSRNYDAFGGPSTGRGRGRGHMGDFGSIHRPGIVVDYQNKSTNVTVAAARGIKRKMMQPFNKPSGTFIKKPKLAKPMEKISLSKSPTKTDPKNEEEEKRRIEARREKQRRRREKNSEKYGDGYRMAFTCSFCKFRTFEEKDIELHLESSSHQETLDHIQKQTKFDKVVMEFLHECMVNKFKKTSIRKQQTNNQTEVVKIIEKDVMEGVTVDDHMMKVETVHCSACSVYIPALHSSVQQHLKSPDHIKGKQAYKEQIKRESVLTATSILNNPIVKARYERFVKGENPFEIQDHSQDQQIEGDEEDEEKIDEPIEEEEDEDEEEEAEEVGEVEEVEEVEEVREGGIEGEGNIQGVGEGGEVGVVGEVEGVGEVEEVEELEEETAKEEPADFPVEQPEEN