You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SLC45A4
Solute carrier family 45 member 4

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000024061
  • ENSP00000024061
  • ENSG00000022567
  • ENST00000519067
  • ENSP00000429059

Symbol
  • KIAA1126
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.88
kinase perturbation
0.84
transcription factor perturbation
0.8
transcription factor
0.78
cell type or tissue
0.7


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.46   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 15   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1.46   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 15   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Sequence or structural Similarity (ISS)
ParkinsonsUK-UCL
Protein-Protein Interactions (34)
1 – 10 of 34
EPS8L3
Tdark
Family: Enzyme
Novelty: 0.36793693
Score: 0.725
Data Source: STRINGDB
SLC6A19
Tchem
Family: Transporter
Novelty: 0.01236925
Score: 0.631
Data Source: STRINGDB
PCNX1
Tbio
Novelty: 0.13683366
Score: 0.591
Data Source: STRINGDB
OR8K5
Tdark
Family: oGPCR
Novelty: 15
Score: 0.56
Data Source: STRINGDB
ONECUT3
Tbio
Family: TF
Novelty: 0.01146116
Score: 0.56
Data Source: STRINGDB
PQLC2L
Tdark
Score: 0.559
Data Source: STRINGDB
ZNF641
Tdark
Family: TF
Novelty: 0.45454545
Score: 0.559
Data Source: STRINGDB
CPQ
Tbio
Family: Enzyme
Novelty: 0.00264241
Score: 0.553
Data Source: STRINGDB
COL18A1
Tbio
Novelty: 0.00063031
Score: 0.551
Data Source: STRINGDB
HOOK2
Tbio
Novelty: 0.05566712
Score: 0.539
Data Source: STRINGDB
Publication Statistics
PubMed Score  1.46

PubMed score by year
PubTator Score  0.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKMAPQNADPESMQVQELSVPLPDPQKAGGAEAENCETISEGSIDRIPMRLWVMHGAVMFGREFCYAMET
1-70
ALVTPILLQIGLPEQYYSLTWFLSPILGLIFTPLIGSASDRCTLSWGRRRPFILALCVGVLFGVALFLNG
70-140
SAIGLALGDVPNRQPIGIVLTVLGVVVLDFSADATEGPIRAYLLDVVDSEEQDMALNIHAFSAGLGGAIG
140-210
YVLGGLDWTQTFLGSWFRTQNQVLFFFAAIIFTVSVALHLFSIDEEQYSPQQERSAEEPGALDGGEPHGV
210-280
PAFPDEVQSEHELALDYPDVDIMRSKSDSALHVPDTALDLEPELLFLHDIEPSIFHDASYPATPRSTSQE
280-350
LAKTKLPRLATFLKEAAKEDETLLDNHLNEAKVPNGSGSPTKDALGGYTRVDTKPSATSSSMRRRRHAFR
350-420
RQASSTFSYYGKLGSHCYRYRRANAVVLIKPSRSMSDLYDMQKRQRQHRHRNQSGATTSSGDTESEEGEG
420-490
ETTVRLLWLSMLKMPRELMRLCLCHLLTWFSVIAEAVFYTDFMGQVIFEGDPKAPSNSTAWQAYNAGVKM
490-560
GCWGLVIYAATGAICSALLQKYLDNYDLSVRVIYVLGTLGFSVGTAVMAMFPNVYVAMVTISTMGIVSMS
560-630
ISYCPYALLGQYHDIKQYIHHSPGNSKRGFGIDCAILSCQVYISQILVASALGGVVDAVGTVRVIPMVAS
630-700
VGSFLGFLTATFLVIYPNVSEEAKEEQKGLSSPLAGEGRAGGNSEKPTVLKLTRKEGLQGPVETESVV
700-768
MKMAPQNADPESMQVQELSVPLPDPQKAGGAEAENCETISEGSIDRIPMRLWVMHGAVMFGREFCYAMETALVTPILLQIGLPEQYYSLTWFLSPILGLIFTPLIGSASDRCTLSWGRRRPFILALCVGVLFGVALFLNGSAIGLALGDVPNRQPIGIVLTVLGVVVLDFSADATEGPIRAYLLDVVDSEEQDMALNIHAFSAGLGGAIGYVLGGLDWTQTFLGSWFRTQNQVLFFFAAIIFTVSVALHLFSIDEEQYSPQQERSAEEPGALDGGEPHGVPAFPDEVQSEHELALDYPDVDIMRSKSDSALHVPDTALDLEPELLFLHDIEPSIFHDASYPATPRSTSQELAKTKLPRLATFLKEAAKEDETLLDNHLNEAKVPNGSGSPTKDALGGYTRVDTKPSATSSSMRRRRHAFRRQASSTFSYYGKLGSHCYRYRRANAVVLIKPSRSMSDLYDMQKRQRQHRHRNQSGATTSSGDTESEEGEGETTVRLLWLSMLKMPRELMRLCLCHLLTWFSVIAEAVFYTDFMGQVIFEGDPKAPSNSTAWQAYNAGVKMGCWGLVIYAATGAICSALLQKYLDNYDLSVRVIYVLGTLGFSVGTAVMAMFPNVYVAMVTISTMGIVSMSISYCPYALLGQYHDIKQYIHHSPGNSKRGFGIDCAILSCQVYISQILVASALGGVVDAVGTVRVIPMVASVGSFLGFLTATFLVIYPNVSEEAKEEQKGLSSPLAGEGRAGGNSEKPTVLKLTRKEGLQGPVETESVV