You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ALG10
Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase

Protein Summary
Description
Adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc(2)Man(9)GlcNAc(2)-PP-Dol. This gene encodes a membrane-associated protein that adds the third glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. That is, it transfers the terminal glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc2Man9GlcNAc(2)-PP-Dol. The rat protein homolog was shown to specifically modulate the gating function of the rat neuronal ether-a-go-go (EAG) potassium ion channel. [provided by RefSeq, Jan 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000266483
  • ENSP00000266483
  • ENSG00000139133

Symbol
  • ALG10A
  • DIE2
  • KCR1
  • ALG10A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.72
cell line
0.7
transcription factor binding site profile
0.64
virus perturbation
0.64
cell type or tissue
0.61


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.13   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 83   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 24.13   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 83   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Asparagine N-linked glycosylation (R-HSA-446203)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Asparagine N-linked glycosylation
Reactome
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Asparagine N-linked glycosylation
Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein
Metabolism of proteins
Post-translational protein modification
Protein-Protein Interactions (63)
1 – 10 of 63
DPEP1
Tclin
Family: Enzyme
Novelty: 0.0033193
p_int: 0.999186064
p_ni: 0.000813936
Data Source: BioPlex
ATP5PF
Tbio
Family: Enzyme
Novelty: 0.00355338
p_int: 0.990046716
p_ni: 0.009953283
Data Source: BioPlex
YIPF3
Tbio
Novelty: 0.03141831
p_int: 0.979970095
p_ni: 0.020029905
Data Source: BioPlex
VIPR2
Tchem
Family: GPCR
Novelty: 0.00602252
p_int: 0.963411593
p_ni: 0.036588407
Data Source: BioPlex
SLC39A4
Tbio
Family: Transporter
Novelty: 0.00826526
p_int: 0.96073466
p_ni: 0.03926534
Data Source: BioPlex
ATP2B2
Tbio
Family: Transporter
Novelty: 0.00724828
p_int: 0.944985954
p_ni: 0.055014046
Data Source: BioPlex
CCR6
Tchem
Family: GPCR
Novelty: 0.00438964
p_int: 0.9423543
p_ni: 0.057645699
p_wrong: 1e-9
Data Source: BioPlex
UPK1A
Tbio
Novelty: 0.02382993
p_int: 0.92984114
p_ni: 0.07015886
Data Source: BioPlex
SPPL2B
Tbio
Family: Enzyme
Novelty: 0.03749833
p_int: 0.9279885
p_ni: 0.0720115
Score: 0.163
Data Source: BioPlex,STRINGDB
SLC22A9
Tbio
Family: Transporter
Novelty: 0.02803169
p_int: 0.909870581
p_ni: 0.090129417
p_wrong: 2e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  24.13

PubMed score by year
PubTator Score  3.49

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLPGLYL
1-70
VSIGVIKPAIWIFGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFCKVQPRNKAASSIQRVLSTLTLAVF
70-140
PTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWK
140-210
TELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLLLLTWPYILLGFLFCAFVVVNGGIVIGDRS
210-280
SHEACLHFPQLFYFFSFTLFFSFPHLLSPSKIKTFLSLVWKRRILFFVVTLVSVFLVWKFTYAHKYLLAD
280-350
NRHYTFYVWKRVFQRYETVKYLLVPAYIFAGWSIADSLKSKSIFWNLMFFICLFTVIVPQKLLEFRYFIL
350-420
PYVIYRLNIPLPPTSRLICELSCYAVVNFITFFIFLNKTFQWPNSQDIQRFMW
420-473
MAQLEGYYFSAALSCTFLVSCLLFSAFSRALREPYMDEIFHLPQAQRYCEGHFSLSQWDPMITTLPGLYLVSIGVIKPAIWIFGWSEHVVCSIGMLRFVNLLFSVGNFYLLYLLFCKVQPRNKAASSIQRVLSTLTLAVFPTLYFFNFLYYTEAGSMFFTLFAYLMCLYGNHKTSAFLGFCGFMFRQTNIIWAVFCAGNVIAQKLTEAWKTELQKKEDRLPPIKGPFAEFRKILQFLLAYSMSFKNLSMLLLLTWPYILLGFLFCAFVVVNGGIVIGDRSSHEACLHFPQLFYFFSFTLFFSFPHLLSPSKIKTFLSLVWKRRILFFVVTLVSVFLVWKFTYAHKYLLADNRHYTFYVWKRVFQRYETVKYLLVPAYIFAGWSIADSLKSKSIFWNLMFFICLFTVIVPQKLLEFRYFILPYVIYRLNIPLPPTSRLICELSCYAVVNFITFFIFLNKTFQWPNSQDIQRFMW