You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NCBP3
Nuclear cap-binding protein subunit 3

Protein Summary
Description
Associates with NCBP1/CBP80 to form an alternative cap-binding complex (CBC) which plays a key role in mRNA export. NCBP3 serves as adapter protein linking the capped RNAs (m7GpppG-capped RNA) to NCBP1/CBP80. Unlike the conventional CBC with NCBP2 which binds both small nuclear RNA (snRNA) and messenger (mRNA) and is involved in their export from the nucleus, the alternative CBC with NCBP3 does not bind snRNA and associates only with mRNA thereby playing a role in only mRNA export. The alternative CBC is particularly important in cellular stress situations such as virus infections and the NCBP3 activity is critical to inhibit virus growth (PubMed:26382858).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000389005
  • ENSP00000373657
  • ENSG00000074356

Symbol
  • C17orf85
  • ELG
  • C17orf85
  • HSA277841
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.41   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 34   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 7.41   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 34   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (10)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (73)
1 – 10 of 73
LARP4B
Tbio
Novelty: 0.153294
p_int: 0.999219104
p_ni: 0.000780896
Data Source: BioPlex
LUC7L2
Tdark
Novelty: 0.46134191
p_int: 0.998930669
p_ni: 0.001069331
Score: 0.212
Data Source: BioPlex,STRINGDB
CCDC9
Tdark
p_int: 0.998872049
p_ni: 0.001127939
p_wrong: 1.2e-8
Data Source: BioPlex
PRPF40A
Tbio
Novelty: 0.01285958
p_int: 0.998866846
p_ni: 0.001133154
Score: 0.353
Data Source: BioPlex,STRINGDB
PNN
Tbio
Novelty: 0.00945912
p_int: 0.998755801
p_ni: 0.001244199
Score: 0.68
Data Source: BioPlex,STRINGDB
CHTOP
Tbio
Novelty: 0.06202642
p_int: 0.998166937
p_ni: 0.001833063
Score: 0.598
Data Source: BioPlex,STRINGDB
GSPT2
Tbio
Family: Enzyme
Novelty: 0.12428326
p_int: 0.99809148
p_ni: 0.00190852
Score: 0.256
Data Source: BioPlex,STRINGDB
SNIP1
Tbio
Novelty: 0.0303933
p_int: 0.994720584
p_ni: 0.005279416
Score: 0.583
Data Source: BioPlex,STRINGDB
WSB2
Tbio
Novelty: 0.06290432
p_int: 0.991595495
p_ni: 0.008404505
Score: 0.663
Data Source: BioPlex,STRINGDB
ELAVL2
Tbio
Novelty: 0.0071859
p_int: 0.975949265
p_ni: 0.024050734
Data Source: BioPlex
Publication Statistics
PubMed Score  7.41

PubMed score by year
PubTator Score  8.6

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAVRGLRVSVKAEAPAGPALGLPSPEAESGVDRGEPEPMEVEEGELEIVPVRRSLKELIPDTSRRYENK
1-70
AGSFITGIDVTSKEAIEKKEQRAKRFHFRSEVNLAQRNVALDRDMMKKAIPKVRLETIYICGVDEMSTQD
70-140
VFSYFKEYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSS
140-210
DDDEAEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGNRLFMRFATKDDKKELGAARRSQYY
210-280
MKYGNPNYGGMKGILSNSWKRRYHSRRIQRDVIKKRALIGDDVGLTSYKHRHSGLVNVPEEPIEEEEEEE
280-350
EEEEEEEEEDQDMDADDRVVVEYHEELPALKQPRERSASRRSSASSSDSDEMDYDLELKMISTPSPKKSM
350-420
KMTMYADEVESQLKNIRNSMRADSVSSSNIKNRIGNKLPPEKFADVRHLLDEKRQHSRPRPPVSSTKSDI
420-490
RQRLGKRPHSPEKAFSSNPVVRREPSSDVHSRLGVPRQDSKGLYADTREKKSGNLWTRLGSAPKTKEKNT
490-560
KKVDHRAPGAEEDDSELQRAWGALIKEKEQSRQKKSRLDNLPSLQIEVSRESSSGSEAES
560-620
MAAVRGLRVSVKAEAPAGPALGLPSPEAESGVDRGEPEPMEVEEGELEIVPVRRSLKELIPDTSRRYENKAGSFITGIDVTSKEAIEKKEQRAKRFHFRSEVNLAQRNVALDRDMMKKAIPKVRLETIYICGVDEMSTQDVFSYFKEYPPAHIEWLDDTSCNVVWLDEMTATRALINMSSLPAQDKIRSRDASEDKSAEKRKKDKQEDSSDDDEAEEGEVEDENSSDVELDTLSQVEEESLLRNDLRPANKLAKGNRLFMRFATKDDKKELGAARRSQYYMKYGNPNYGGMKGILSNSWKRRYHSRRIQRDVIKKRALIGDDVGLTSYKHRHSGLVNVPEEPIEEEEEEEEEEEEEEEEDQDMDADDRVVVEYHEELPALKQPRERSASRRSSASSSDSDEMDYDLELKMISTPSPKKSMKMTMYADEVESQLKNIRNSMRADSVSSSNIKNRIGNKLPPEKFADVRHLLDEKRQHSRPRPPVSSTKSDIRQRLGKRPHSPEKAFSSNPVVRREPSSDVHSRLGVPRQDSKGLYADTREKKSGNLWTRLGSAPKTKEKNTKKVDHRAPGAEEDDSELQRAWGALIKEKEQSRQKKSRLDNLPSLQIEVSRESSSGSEAES