You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CRTC2
CREB-regulated transcription coactivator 2

Protein Summary
Description
Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. Regulates the expression of specific genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR). This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cel ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000368633
  • ENSP00000357622
  • ENSG00000160741

Symbol
  • TORC2
  • TORC2
  • TORC-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.85
kinase
0.84
transcription factor binding site profile
0.8
biological term
0.7
transcription factor
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 40.71   (req: < 5)
Gene RIFs: 24   (req: <= 3)
Antibodies: 492   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 40.71   (req: >= 5)
Gene RIFs: 24   (req: > 3)
Antibodies: 492   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Circadian Clock (R-HSA-400253)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Circadian Clock
Reactome
Mitochondrial biogenesis
Reactome
Organelle biogenesis and maintenance
Reactome
Transcriptional activation of mitochondrial biogenesis
Name
Explore in Pharos
Explore in Source
Circadian Clock
Mitochondrial biogenesis
Organelle biogenesis and maintenance
Transcriptional activation of mitochondrial biogenesis
Protein-Protein Interactions (84)
1 – 10 of 84
WDYHV1
Tdark
Family: Enzyme
Novelty: 0.23412216
p_int: 0.988727982
p_ni: 0.000002159
p_wrong: 0.011269858
Data Source: BioPlex
PPP3CC
Tbio
Family: Enzyme
Novelty: 0.04180044
p_int: 0.988717653
p_ni: 0.011282346
p_wrong: 1e-9
Score: 0.955
Data Source: BioPlex,STRINGDB
PPP3R1
Tbio
Novelty: 0.00213192
p_int: 0.945825137
p_ni: 0.054174863
Score: 0.902
Data Source: BioPlex,STRINGDB
YWHAZ
Tbio
Novelty: 0.00235606
p_int: 0.919147043
p_ni: 0.080852957
Score: 0.914
Data Source: BioPlex,STRINGDB
YWHAG
Tbio
Novelty: 0.01155855
p_int: 0.86491948
p_ni: 0.13508052
Score: 0.914
Data Source: BioPlex,STRINGDB
YWHAE
Tbio
Novelty: 0.00548639
p_int: 0.796732635
p_ni: 0.203267365
Score: 0.917
Data Source: BioPlex,STRINGDB
PPP3CB
Tbio
Family: Enzyme
Novelty: 0.02520885
p_int: 0.766784963
p_ni: 0.233215037
Score: 0.944
Data Source: BioPlex,STRINGDB
CREB1
Tbio
Family: TF
Novelty: 0.00022127
Score: 0.999
Data Source: Reactome,STRINGDB
SIK2
Tchem
Family: Kinase
Novelty: 0.02679057
Score: 0.987
Data Source: STRINGDB
SIK1
Tchem
Family: Kinase
Novelty: 0.00660123
Score: 0.969
Data Source: STRINGDB
Publication Statistics
PubMed Score  40.71

PubMed score by year
PubTator Score  91.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGS
1-70
LPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPE
70-140
SSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMD
140-210
PKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTN
210-280
LHFPPPLPTPLDPEETAYPSLSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNP
280-350
NLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPAST
350-420
PGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSS
420-490
PSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLE
490-560
QFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKE
560-630
IAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ
630-693
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAYTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRRYTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVMNPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPSLSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQPQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTFNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRMEPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ