You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FNDC3B
Fibronectin type III domain-containing protein 3B

Protein Summary
Description
May be a positive regulator of adipogenesis.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000336824
  • ENSP00000338523
  • ENSG00000075420
  • ENST00000415807
  • ENSP00000411242
  • ENST00000416957
  • ENSP00000389094
  • ENST00000421757
  • ENSP00000408496
  • ENST00000423424
  • ENSP00000392471

Symbol
  • FAD104
  • NS5ABP37
  • FAD104
  • PRO4979
  • YVTM2421
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.98
transcription factor binding site profile
0.95
PubMedID
0.94
microRNA
0.91
virus perturbation
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.79   (req: < 5)
Gene RIFs: 12   (req: <= 3)
Antibodies: 127   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.79   (req: >= 5)
Gene RIFs: 12   (req: > 3)
Antibodies: 127   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (2)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (45)
1 – 10 of 45
TENT5A
Tbio
Novelty: 0.10907364
p_int: 1
Score: 0.687
Data Source: BioPlex,STRINGDB
RBFOX2
Tbio
Novelty: 0.01237106
p_int: 0.999966973
p_ni: 0.000032964
p_wrong: 6.3e-8
Score: 0.198
Data Source: BioPlex,STRINGDB
SPINT2
Tbio
Family: Enzyme
Novelty: 0.00575409
p_int: 0.996474884
p_ni: 0.000051808
p_wrong: 0.003473308
Data Source: BioPlex
FAM189B
Tbio
Novelty: 0.62780269
p_int: 0.988452204
p_ni: 0.000107281
p_wrong: 0.011440515
Score: 0.422
Data Source: BioPlex,STRINGDB
KLRG2
Tdark
Novelty: 0.77419355
p_int: 0.98736827
p_ni: 0.000053953
p_wrong: 0.012577777
Score: 0.249
Data Source: BioPlex,STRINGDB
ZNF469
Tbio
Family: TF
Novelty: 0.04662079
Score: 0.672
Data Source: STRINGDB
B3GNT7
Tbio
Family: Enzyme
Novelty: 0.21671827
Score: 0.647
Data Source: STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.585
Data Source: STRINGDB
TMCO1
Tbio
Novelty: 0.05789366
Score: 0.575
Data Source: STRINGDB
TRIP13
Tbio
Family: Enzyme
Novelty: 0.01029585
Score: 0.547
Data Source: STRINGDB
Publication Statistics
PubMed Score  29.79

PubMed score by year
PubTator Score  14.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MYVTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMM
1-70
SPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTA
70-140
YYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSKPPHKKLKDRQIDRQNRLNSPP
140-210
SSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIE
210-280
KPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATD
280-350
YHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGK
350-420
RNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITW
420-490
VTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPS
490-560
EVLVCTTSPDRPGPPTRPLVKGPVTSHGFSVKWDPPKDNGGSEILKYLLEITDGNSEANQWEVAYSGSAT
560-630
EYTFTHLKPGTLYKLRACCISTGGHSQCSESLPVRTLSIAPGQCRPPRVLGRPKHKEVHLEWDVPASESG
630-700
CEVSEYSVEMTEPEDVASEVYHGPELECTVGNLLPGTVYRFRVRALNDGGYGPYSDVSEITTAAGPPGQC
700-770
KAPCISCTPDGCVLVGWESPDSSGADISEYRLEWGEDEESLELIYHGTDTRFEIRDLLPAAQYCCRLQAF
770-840
NQAGAGPYSELVLCQTPASAPDPVSTLCVLEEEPLDAYPDSPSACLVLNWEEPCNNGSEILAYTIDLGDT
840-910
SITVGNTTMHVMKDLLPETTYRIRIQAINEIGAGPFSQFIKAKTRPLPPLPPRLECAAAGPQSLKLKWGD
910-980
SNSKTHAAEDIVYTLQLEDRNKRFISIYRGPSHTYKVQRLTEFTCYSFRIQAASEAGEGPFSETYTFSTT
980-1050
KSVPPTIKAPRVTQLEGNSCEILWETVPSMKGDPVNYILQVLVGRESEYKQVYKGEEATFQISGLQTNTD
1050-1120
YRFRVCACRRCLDTSQELSGAFSPSAAFVLQRSEVMLTGDMGSLDDPKMKSMMPTDEQFAAIIVLGFATL
1120-1190
SILFAFILQYFLMK
1190-1204
MYVTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQCIQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPTHHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSTYITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGSGPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPVGLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYNSVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGKRNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSAPRLVRAGITWVTLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKRSTQYKFRLTASNTEGKSCPSEVLVCTTSPDRPGPPTRPLVKGPVTSHGFSVKWDPPKDNGGSEILKYLLEITDGNSEANQWEVAYSGSATEYTFTHLKPGTLYKLRACCISTGGHSQCSESLPVRTLSIAPGQCRPPRVLGRPKHKEVHLEWDVPASESGCEVSEYSVEMTEPEDVASEVYHGPELECTVGNLLPGTVYRFRVRALNDGGYGPYSDVSEITTAAGPPGQCKAPCISCTPDGCVLVGWESPDSSGADISEYRLEWGEDEESLELIYHGTDTRFEIRDLLPAAQYCCRLQAFNQAGAGPYSELVLCQTPASAPDPVSTLCVLEEEPLDAYPDSPSACLVLNWEEPCNNGSEILAYTIDLGDTSITVGNTTMHVMKDLLPETTYRIRIQAINEIGAGPFSQFIKAKTRPLPPLPPRLECAAAGPQSLKLKWGDSNSKTHAAEDIVYTLQLEDRNKRFISIYRGPSHTYKVQRLTEFTCYSFRIQAASEAGEGPFSETYTFSTTKSVPPTIKAPRVTQLEGNSCEILWETVPSMKGDPVNYILQVLVGRESEYKQVYKGEEATFQISGLQTNTDYRFRVCACRRCLDTSQELSGAFSPSAAFVLQRSEVMLTGDMGSLDDPKMKSMMPTDEQFAAIIVLGFATLSILFAFILQYFLMK