You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DNAL1
Dynein light chain 1, axonemal

Protein Summary
Description
Part of the multisubunit axonemal ATPase complexes that generate the force for cilia motility and govern beat frequency (By similarity). Component of the outer arm dynein (ODA). May be involved in a mechanosensory feedback mechanism controlling ODA activity based on external conformational cues by tethering the outer arm dynein heavy chain (DNAH5) to the microtubule within the axoneme (By similarity). Important for ciliary function in the airways and for the function of the cilia that produce the nodal flow essential for the determination of the left-right asymmetry (PubMed:21496787). This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. Alternate splicing results in multiple transcript variants ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000311089
  • ENSP00000310360
  • ENSG00000119661
  • ENST00000553645
  • ENSP00000452037
  • ENST00000554871
  • ENSP00000451834

Symbol
  • C14orf168
  • LC1
  • CILD16
  • C14orf168
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.89
microRNA
0.78
kinase perturbation
0.76
tissue sample
0.68
transcription factor perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 101.92   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 195   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 101.92   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 195   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (73)
1 – 10 of 73
RAP1GDS1
Tbio
Family: Enzyme
Novelty: 0.04627419
p_int: 0.986331883
p_ni: 0.013668117
Score: 0.689
Data Source: BioPlex,STRINGDB
RHOA
Tbio
Family: Enzyme
Novelty: 0.0002729
p_int: 0.985533027
p_ni: 0.014466973
Score: 0.834
Data Source: BioPlex,STRINGDB
DNAH5
Tbio
Novelty: 0.02916014
Score: 0.973
Data Source: STRINGDB
DNAI2
Tbio
Novelty: 0.04401314
Score: 0.922
Data Source: STRINGDB
DNALI1
Tdark
Novelty: 0.25184889
Score: 0.895
Data Source: STRINGDB
DNAL4
Tdark
Novelty: 0.2970297
Score: 0.876
Data Source: STRINGDB
TCTE3
Tdark
Novelty: 0.1998141
Score: 0.868
Data Source: STRINGDB
DNAH3
Tdark
Novelty: 0.0828216
Score: 0.845
Data Source: STRINGDB
DNAI1
Tbio
Novelty: 0.01683297
Score: 0.844
Data Source: STRINGDB
DNAH7
Tbio
Novelty: 0.24742268
Score: 0.824
Data Source: STRINGDB
Publication Statistics
PubMed Score  101.92

PubMed score by year
PubTator Score  3.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLK
1-70
NLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELP
70-140
CLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN
140-190
MAKATTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLSLSTNCIEKIANLNGLKNLRILSLGRNNIKNLNGLEAVGDTLEELWISYNFIEKLKGIHIMKKLKILYMSNNLVKDWAEFVKLAELPCLEDLVFVGNPLEEKHSAENNWIEEATKRVPKLKKLDGTPVIKGDEEEDN