You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GLYR1
Putative oxidoreductase GLYR1

Protein Summary
Description
Putative oxidoreductase that is recruited on chromatin and promotes KDM1B demethylase activity (PubMed:23260659). Recognizes and binds trimethylated 'Lys-36' of histone H3 (H3K36me3) (PubMed:20850016). Regulates p38 MAP kinase activity by mediating stress activation of p38alpha/MAPK14 and specifically regulating MAPK14 signaling (PubMed:16352664). Indirectly promotes phosphorylation of MAPK14 and activation of ATF2 (PubMed:16352664). The phosphorylation of MAPK14 requires upstream activity of MAP2K4 and MAP2K6 (PubMed:16352664).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000321919
  • ENSP00000322716
  • ENSG00000140632
  • ENST00000436648
  • ENSP00000390276
  • ENST00000591451
  • ENSP00000468328

Symbol
  • HIBDL
  • NP60
  • NP60
  • BM045
  • HIBDL
  • N-PAC
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
interacting protein
0.84
disease perturbation
0.83
transcription factor perturbation
0.8
small molecule perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 63.3   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 96   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 63.3   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 96   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (11)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (99)
1 – 10 of 99
KDM1B
Tbio
Family: Epigenetic
Novelty: 0.03022771
p_int: 0.999998651
p_ni: 0.000001349
Score: 0.566
Data Source: BioPlex,STRINGDB
MAGEA1
Tbio
Novelty: 0.00581327
p_int: 0.997868906
p_ni: 0.002131094
Data Source: BioPlex
WDR46
Tdark
Novelty: 0.36421448
p_int: 0.985121707
p_ni: 0.014878293
Data Source: BioPlex
ZNF2
Tbio
Family: TF
Novelty: 0.01993056
p_int: 0.97401479
p_ni: 0.02598521
Score: 0.252
Data Source: BioPlex,STRINGDB
SERPINA12
Tbio
Novelty: 0.00636095
p_int: 0.968486473
p_ni: 0.031513527
Data Source: BioPlex
RPL8
Tbio
Novelty: 0.03315002
p_int: 0.964211397
p_ni: 0.035788603
Score: 0.561
Data Source: BioPlex,STRINGDB
FNTB
Tchem
Family: Enzyme
Novelty: 0.13625417
p_int: 0.961462004
p_ni: 0.038183319
p_wrong: 0.000354677
Data Source: BioPlex
RPL37A
Tbio
Novelty: 0.03125092
p_int: 0.956444841
p_ni: 0.043555159
Score: 0.303
Data Source: BioPlex,STRINGDB
NOP53
Tbio
Novelty: 0.00473377
p_int: 0.952648844
p_ni: 0.047351156
Score: 0.221
Data Source: BioPlex,STRINGDB
RPL28
Tbio
Novelty: 0.0322797
p_int: 0.949494288
p_ni: 0.050505712
Data Source: BioPlex
Publication Statistics
PubMed Score  63.30

PubMed score by year
PubTator Score  9.7

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEM
1-70
IKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSDDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNM
70-140
GEGKKRVSSGSSERGSKSPLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPV
140-210
KDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGS
210-280
GIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQG
280-350
IRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAM
350-420
GKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNIL
420-490
QGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH
490-553
MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSDDKNRRNSSEERSRPNSGDEKRKLSLSEGKVKKNMGEGKKRVSSGSSERGSKSPLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH