You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
VMA21
Vacuolar ATPase assembly integral membrane protein VMA21

Protein Summary
Description
Required for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum. This gene encodes a chaperone for assembly of lysosomal vacuolar ATPase.[provided by RefSeq, Jul 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000330374
  • ENSP00000333255
  • ENSG00000160131
  • ENST00000370361
  • ENSP00000359386

Symbol
  • MEAX
  • XMEA
  • MEAX
  • XMEA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.94
histone modification site profile
0.88
microRNA
0.75
cellular component
0.73
small molecule perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 70   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 70   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (7)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
LIFEdb
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (44)
1 – 10 of 44
ATP6AP2
Tbio
Novelty: 0.00332722
p_int: 0.99999589
p_ni: 0.000004106
p_wrong: 4e-9
Score: 0.901
Data Source: BioPlex,STRINGDB
CMTM8
Tbio
Novelty: 0.13251301
p_int: 0.999994578
p_ni: 0.000004736
p_wrong: 6.86e-7
Data Source: BioPlex
KIAA2013
Tdark
Novelty: 4
p_int: 0.999990941
p_ni: 0.000006715
p_wrong: 0.000002344
Score: 0.851
Data Source: BioPlex,STRINGDB
ATP6V0D1
Tbio
Family: Enzyme
Novelty: 0.08236951
p_int: 0.999936914
p_ni: 0.000063083
p_wrong: 2e-9
Score: 0.765
Data Source: BioPlex,STRINGDB
ATP6V0D2
Tbio
Family: Enzyme
Novelty: 0.05090653
p_int: 0.999932317
p_ni: 0.000065671
p_wrong: 0.000002012
Score: 0.883
Data Source: BioPlex,STRINGDB
TMEM199
Tbio
Novelty: 0.07334803
p_int: 0.999893716
p_ni: 0.000103901
p_wrong: 0.000002383
Score: 0.935
Data Source: BioPlex,STRINGDB
ATP6V0A2
Tbio
Family: Enzyme
Novelty: 0.0033925
p_int: 0.999805051
p_ni: 0.000194949
Score: 0.753
Data Source: BioPlex,STRINGDB
TNFSF18
Tbio
Novelty: 0.01752002
p_int: 0.999606268
p_ni: 0.000237155
p_wrong: 0.000156577
Data Source: BioPlex
ECSCR
Tbio
Novelty: 0.10915706
p_int: 0.999413497
p_ni: 0.000586455
p_wrong: 4.7e-8
Data Source: BioPlex
METTL9
Tdark
Family: Enzyme
Novelty: 0.16438356
p_int: 0.998438022
p_ni: 0.001547967
p_wrong: 0.000014011
Data Source: BioPlex
Publication Statistics
PubTator Score  19.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAI
1-70
VAVVAVHVVLALFVYVAWNEGSRQWREGKQD
70-101
MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAIVAVVAVHVVLALFVYVAWNEGSRQWREGKQD