You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
C2orf76
UPF0538 protein C2orf76

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000334816
  • ENSP00000335041
  • ENSG00000186132
  • ENST00000409466
  • ENSP00000386302
  • ENST00000409523
  • ENSP00000386714
  • ENST00000409877
  • ENSP00000387234

Symbol
  • AIM29
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.59   (req: < 5)
Gene RIFs: 2   (req: <= 3)
Antibodies: 57   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.59   (req: >= 5)
Gene RIFs: 2   (req: > 3)
Antibodies: 57   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 0
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (4)
1 – 4 of 4
PLPBP
Tbio
Family: Enzyme
Novelty: 0.0468506
Score: 0.735
Data Source: STRINGDB
COX14
Tbio
Family: Enzyme
Novelty: 0.13817305
Score: 0.51
Data Source: STRINGDB
PBDC1
Tdark
Novelty: 1.5
Score: 0.451
Data Source: STRINGDB
GABRG3
Tclin
Family: IC
Novelty: 0.08670927
Score: 0.4
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.59

PubMed score by year
PubTator Score  1.67

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQA
1-70
HKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW
70-126
MAPGEVTITVRLIRSFEHRNFKPVVYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALKIIHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISSW