You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SLC10A6
Solute carrier family 10 member 6

Protein Summary
Description
Transports sulfoconjugated steroid hormones, as well as taurolithocholic acid-3-sulfate and sulfoconjugated pyrenes in a sodium-dependent manner.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000273905
  • ENSP00000273905
  • ENSG00000145283

Symbol
  • SOAT
  • SOAT
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.9
cell type or tissue
0.8
tissue sample
0.74
tissue
0.54
metabolite
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.13   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 40   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.13   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 40   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
SLC-mediated transmembrane transport (R-HSA-425407)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of bile salts and organic acids, metal ions and amine compounds
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
SLC-mediated transmembrane transport
Transport of bile salts and organic acids, metal ions and amine compounds
Transport of small molecules
Protein-Protein Interactions (10)
1 – 10 of 10
SLC10A7
Tbio
Family: Transporter
Novelty: 0.16575676
Score: 0.712
Data Source: STRINGDB
SLC35F2
Tbio
Family: Transporter
Novelty: 0.14326322
Score: 0.485
Data Source: STRINGDB
SLC15A5
Tdark
Family: Transporter
Novelty: 1.93548387
Score: 0.48
Data Source: STRINGDB
SULT2A1
Tbio
Family: Enzyme
Novelty: 0.00305442
Score: 0.465
Data Source: STRINGDB
MFSD5
Tdark
Novelty: 0.86956522
Score: 0.447
Data Source: STRINGDB
MFSD9
Tdark
Novelty: 1.01694915
Score: 0.441
Data Source: STRINGDB
SLCO1B7
Tdark
Family: Transporter
Novelty: 0.90702432
Score: 0.433
Data Source: STRINGDB
SLC7A14
Tbio
Family: Transporter
Novelty: 0.17811121
Score: 0.427
Data Source: STRINGDB
CTRL
Tchem
Family: Enzyme
Novelty: 0.00069832
Score: 0.426
Data Source: STRINGDB
SLC22A9
Tbio
Family: Transporter
Novelty: 0.02803169
Score: 0.402
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.13

PubMed score by year
PubTator Score  10.27

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAV
1-70
GLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGM
70-140
MPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAV
140-210
AGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTA
210-280
EHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEE
280-350
GAITPGPPGPMDCHRALEPVGHITSCE
350-377
MRANCSSSSACPANSSEEELPVGLEVHGNLELVFTVVSTVMMGLLMFSLGCSVEIRKLWSHIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIILKIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLSFTAEHLVQMLSFPLAYGLFQLIDGFLIVAAYQTYKRRLKNKHGKKNSGCTEVCHTRKSTSSRETNAFLEVNEEGAITPGPPGPMDCHRALEPVGHITSCE