You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NDUFAF6
NADH dehydrogenase (ubiquinone) complex I, assembly factor 6

Protein Summary
Description
Involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I) at early stages. May play a role in the biogenesis of MT-ND1. This gene encodes a protein that localizes to mitochondria and contains a predicted phytoene synthase domain. The encoded protein plays an important role in the assembly of complex I (NADH-ubiquinone oxidoreductase) of the mitochondrial respiratory chain through regulation of subunit ND1 biogenesis. Mutations in this gene are associated with complex I enzymatic deficiency. [provided by RefSeq, Nov 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000396124
  • ENSP00000379430
  • ENSG00000156170
  • ENST00000518258
  • ENSP00000428788
  • ENST00000523337
  • ENSP00000429038

Symbol
  • C8orf38
  • C8orf38
  • MC1DN17
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.89
transcription factor binding site profile
0.69
cell line
0.68
transcription factor perturbation
0.68
cellular component
0.67


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.31   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 17   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 12.31   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 17   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
Complex I biogenesis (R-HSA-6799198)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complex I biogenesis
Reactome
Metabolism
Reactome
Respiratory electron transport
Reactome
Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
Reactome
The citric acid (TCA) cycle and respiratory electron transport
Name
Explore in Pharos
Explore in Source
Complex I biogenesis
Metabolism
Respiratory electron transport
Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
The citric acid (TCA) cycle and respiratory electron transport
Gene Ontology Terms (5)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (116)
1 – 10 of 116
GALNT6
Tbio
Family: Enzyme
Novelty: 0.05422688
p_int: 0.999996615
p_ni: 1.82e-7
p_wrong: 0.000003202
Score: 0.277
Data Source: BioPlex,STRINGDB
NDUFAF5
Tbio
Family: Enzyme
Novelty: 0.19033233
Score: 0.985
Data Source: Reactome,STRINGDB
NDUFAF7
Tbio
Family: Enzyme
Novelty: 0.26143791
Score: 0.979
Data Source: STRINGDB
NDUFAF4
Tclin
Family: Enzyme
Novelty: 0.18993352
Score: 0.976
Data Source: Reactome,STRINGDB
NDUFAF1
Tclin
Novelty: 0.0776632
Score: 0.974
Data Source: STRINGDB
NDUFA10
Tclin
Family: Enzyme
Novelty: 0.10106317
Score: 0.974
Data Source: STRINGDB
NDUFS2
Tclin
Family: Enzyme
Novelty: 0.00268424
Score: 0.971
Data Source: STRINGDB
ACAD9
Tbio
Family: Enzyme
Novelty: 0.0452113
Score: 0.97
Data Source: STRINGDB
NDUFAF2
Tclin
Novelty: 0.06538322
Score: 0.969
Data Source: STRINGDB
TMEM126B
Tdark
Novelty: 0.28981265
Score: 0.964
Data Source: STRINGDB
Publication Statistics
PubMed Score  12.31

PubMed score by year
PubTator Score  8.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASAHGSVWGPLRLGIPGLCCRRPPLGLYARMRRLPGPEVSGRSVAAASGPGAWGTDHYCLELLRKRDY
1-70
EGYLCSLLLPAESRSSVFALRAFNVELAQVKDSVSEKTIGLMRMQFWKKTVEDIYCDNPPHQPVAIELWK
70-140
AVKRHNLTKRWLMKIVDEREKNLDDKAYRNIKELENYAENTQSSLLYLTLEILGIKDLHADHAASHIGKA
140-210
QGIVTCLRATPYHGSRRKVFLPMDICMLHGVSQEDFLRRNQDKNVRDVIYDIASQAHLHLKHARSFHKTV
210-280
PVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLYIQSWRKTY
280-333
MAASAHGSVWGPLRLGIPGLCCRRPPLGLYARMRRLPGPEVSGRSVAAASGPGAWGTDHYCLELLRKRDYEGYLCSLLLPAESRSSVFALRAFNVELAQVKDSVSEKTIGLMRMQFWKKTVEDIYCDNPPHQPVAIELWKAVKRHNLTKRWLMKIVDEREKNLDDKAYRNIKELENYAENTQSSLLYLTLEILGIKDLHADHAASHIGKAQGIVTCLRATPYHGSRRKVFLPMDICMLHGVSQEDFLRRNQDKNVRDVIYDIASQAHLHLKHARSFHKTVPVKAFPAFLQTVSLEDFLKKIQRVDFDIFHPSLQQKNTLLPLYLYIQSWRKTY