You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
EXOC3L2
Exocyst complex component 3-like protein 2

Protein Summary
Description
The protein encoded by this gene is upregulated by vascular endothelial growth factor A and interacts with exocyst complex component 4. The encoded protein may be part of an exocyst complex that plays a role in cell membrane dynamics. Mutations in this gene may be associated with Alzheimer's disease. [provided by RefSeq, May 2017]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000252482
  • ENSP00000252482
  • ENSG00000283632

Symbol
  • XTP7
  • XTP7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.72
tissue sample
0.64
tissue
0.59
cell line
0.55
kinase perturbation
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.6   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 80   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 6.6   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 80   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (57)
1 – 10 of 57
SIAH1
Tbio
Family: Enzyme
Novelty: 0.01035087
p_int: 0.999993038
p_ni: 0.000006962
Score: 0.416
Data Source: BioPlex,STRINGDB
MIPEP
Tbio
Family: Enzyme
Novelty: 0.02165125
p_int: 0.99671742
p_ni: 0.00328258
Score: 0.246
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.808182977
p_ni: 0.191817023
Data Source: BioPlex
EXOC4
Tbio
Novelty: 0.02000189
Score: 0.899
Data Source: STRINGDB
EXOC5
Tbio
Novelty: 0.03153548
Score: 0.888
Data Source: STRINGDB
EXOC7
Tbio
Novelty: 0.01322945
Score: 0.882
Data Source: STRINGDB
EXOC8
Tbio
Novelty: 0.06047806
Score: 0.84
Data Source: STRINGDB
EXOC2
Tbio
Novelty: 0.01798053
Score: 0.822
Data Source: STRINGDB
PICALM
Tbio
Novelty: 0.01012802
Score: 0.728
Data Source: STRINGDB
EXOC1
Tbio
Novelty: 0.01279762
Score: 0.716
Data Source: STRINGDB
Publication Statistics
PubMed Score  6.60

PubMed score by year
PubTator Score  7.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQDVCELLEEHT
1-70
ERAPRISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTYISKTIALVNCGPPLRALAER
70-140
LARVGPPESEPAREASASALDHVTRLCHRVVANLLFQELQPHFNKLMRRKWLSSPEALDGIVGTLGAQAL
140-210
ALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWL
210-280
DAVVPHLAEVMQLEDTPSIQVEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGA
280-350
LSPPRDRAFFADIPVPRPSFCLSLPLFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR
350-409
MAALENGELGPLLSPGTLRGLEDECVTDVKAQTRAALLRVLQEDEEHWGSLEDQPSSLAQDVCELLEEHTERAPRISQEFGERMAHCCLGGLAEFLQSFQQRVERFHENPAVREMLPDTYISKTIALVNCGPPLRALAERLARVGPPESEPAREASASALDHVTRLCHRVVANLLFQELQPHFNKLMRRKWLSSPEALDGIVGTLGAQALALRRMQDEPYQALVAELHRRALVEYVRPLLRGRLRCSSARTRSRVAGRLREDAAQLQRLFRRLESQASWLDAVVPHLAEVMQLEDTPSIQVEVGVLVRDYPDIRQKHVAALLDIRGLRNTAARQEILAVARDLELSEEGALSPPRDRAFFADIPVPRPSFCLSLPLFLGRLPLSRLARPSLACLPRPRPPSLARPRAQR