You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ME3
NADP-dependent malic enzyme, mitochondrial

Protein Summary
Description
Malic enzyme catalyzes the oxidative decarboxylation of malate to pyruvate using either NAD+ or NADP+ as a cofactor. Mammalian tissues contain 3 distinct isoforms of malic enzyme: a cytosolic NADP(+)-dependent isoform, a mitochondrial NADP(+)-dependent isoform, and a mitochondrial NAD(+)-dependent isoform. This gene encodes a mitochondrial NADP(+)-dependent isoform. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of some variants has not been determined. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000393324
  • ENSP00000376998
  • ENSG00000151376
  • ENST00000526504
  • ENSP00000433636
  • ENST00000543262
  • ENSP00000440246

Symbol
  • NADP-ME
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.91
molecular function
0.84
protein domain
0.73
cellular component
0.66
disease
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 204.9   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 121   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 204.9   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 121   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Citric acid cycle (TCA cycle) (R-HSA-71403)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Citric acid cycle (TCA cycle)
Reactome
Metabolism
Reactome
Pyruvate metabolism and Citric Acid (TCA) cycle
Reactome
The citric acid (TCA) cycle and respiratory electron transport
Name
Explore in Pharos
Explore in Source
Citric acid cycle (TCA cycle)
Metabolism
Pyruvate metabolism and Citric Acid (TCA) cycle
The citric acid (TCA) cycle and respiratory electron transport
Gene Ontology Terms (15)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Protein-Protein Interactions (74)
1 – 10 of 74
MDH2
Tchem
Family: Enzyme
Novelty: 0.00378295
Score: 0.978
Data Source: STRINGDB
PC
Tbio
Family: Enzyme
Novelty: 0.00322567
Score: 0.972
Data Source: STRINGDB
MDH1
Tbio
Family: Enzyme
Novelty: 0.00241236
Score: 0.971
Data Source: STRINGDB
PKLR
Tbio
Family: Kinase
Novelty: 0.00411221
Score: 0.965
Data Source: STRINGDB
FH
Tbio
Family: Enzyme
Novelty: 0.00322094
Score: 0.957
Data Source: STRINGDB
PKM
Tchem
Family: Kinase
Novelty: 0.00066016
Score: 0.956
Data Source: STRINGDB
PDHA1
Tbio
Family: Enzyme
Novelty: 0.00498626
Score: 0.931
Data Source: STRINGDB
PDHB
Tbio
Family: Enzyme
Novelty: 0.01625694
Score: 0.92
Data Source: STRINGDB
PDHA2
Tbio
Family: Enzyme
Novelty: 0.06763029
Score: 0.919
Data Source: STRINGDB
CS
Tbio
Family: Enzyme
Novelty: 0.00182322
Score: 0.918
Data Source: STRINGDB
Publication Statistics
PubMed Score  204.90

PubMed score by year
PubTator Score  50.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEER
1-70
LQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPT
70-140
VGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLA
140-210
LYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFE
210-280
DFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVM
280-350
ALEKEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGA
350-420
FTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNA
420-490
YVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHN
490-560
LASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
560-604
MGAALGTGTRLAPWPGRACGALPRWTPTAPAQGCHSKPGPARPVPLKKRGYDVTRNPHLNKGMAFTLEERLQLGIHGLIPPCFLSQDVQLLRIMRYYERQQSDLDKYIILMTLQDRNEKLFYRVLTSDVEKFMPIVYTPTVGLACQHYGLTFRRPRGLFITIHDKGHLATMLNSWPEDNIKAVVVTDGERILGLGDLGCYGMGIPVGKLALYTACGGVNPQQCLPVLLDVGTNNEELLRDPLYIGLKHQRVHGKAYDDLLDEFMQAVTDKFGINCLIQFEDFANANAFRLLNKYRNKYCMFNDDIQGTASVAVAGILAALRITKNKLSNHVFVFQGAGEAAMGIAHLLVMALEKEGVPKAEATRKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPEVNSLEEVVRLVKPTAIIGVAAIAGAFTEQILRDMASFHERPIIFALSNPTSKAECTAEKCYRVTEGRGIFASGSPFKSVTLEDGKTFIPGQGNNAYVFPGVALGVIAGGIRHIPDEIFLLTAEQIAQEVSEQHLSQGRLYPPLSTIRDVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV