You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DUSP5
Dual specificity protein phosphatase 5

Protein Summary
Description
Dual specificity protein phosphatase; active with phosphotyrosine, phosphoserine and phosphothreonine residues. The highest relative activity is toward ERK1. The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK1, is expressed in a variety of tissues with the highest levels in pancreas and brain, and is localized in the ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369583
  • ENSP00000358596
  • ENSG00000138166

Symbol
  • VH3
  • DUSP
  • HVH3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
1
gene perturbation
0.97
protein domain
0.97
transcription factor binding site profile
0.94
small molecule perturbation
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 371.12   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 251   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 371.12   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 251   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (16)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
FLT3 Signaling
Reactome
Immune System
Reactome
MAPK family signaling cascades
Reactome
MAPK1/MAPK3 signaling
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
FLT3 Signaling
Immune System
MAPK family signaling cascades
MAPK1/MAPK3 signaling
Protein-Protein Interactions (70)
1 – 10 of 70
MAPK1
Tchem
Family: Kinase
Novelty: 0.00046573
Score: 0.99
Data Source: Reactome,STRINGDB
MAPK3
Tchem
Family: Kinase
Novelty: 0.0001911
Score: 0.986
Data Source: Reactome,STRINGDB
MAPK8
Tchem
Family: Kinase
Novelty: 0.00013952
Score: 0.87
Data Source: STRINGDB
MAPK14
Tchem
Family: Kinase
Novelty: 0.00018655
Score: 0.826
Data Source: STRINGDB
MAPK9
Tchem
Family: Kinase
Novelty: 0.00197999
Score: 0.804
Data Source: STRINGDB
DUSP11
Tbio
Family: Enzyme
Novelty: 0.03494731
Score: 0.804
Data Source: STRINGDB
MAPK10
Tchem
Family: Kinase
Novelty: 0.0047523
Score: 0.766
Data Source: STRINGDB
MAPK11
Tchem
Family: Kinase
Novelty: 0.00860226
Score: 0.764
Data Source: STRINGDB
SNRK
Tbio
Family: Kinase
Novelty: 0.01586802
Score: 0.763
Data Source: STRINGDB
MAPK12
Tchem
Family: Kinase
Novelty: 0.01020422
Score: 0.763
Data Source: STRINGDB
Publication Statistics
PubMed Score  371.12

PubMed score by year
PubTator Score  46.19

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAVSARYVLPDEA
1-70
ARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGPRVYFLKGGYETFYSEYPECC
70-140
VDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYLGSAYHASKCEFLANLHITALLN
140-210
VSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMK
210-280
TKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQ
280-350
GAYCTFPASVLAPVPTHSTVSELSRSPVATATSC
350-384
MKVTSLDGRQLRKMLRKEAAARCVVLDCRPYLAFAASNVRGSLNVNLNSVVLRRARGGAVSARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGPRVYFLKGGYETFYSEYPECCVDVKPISQEKIESERALISQCGKPVVNVSYRPAYDQGGPVEILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACATHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHCEAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYESEILPSTPNPQPPSCQGEAAGSSLIGHLQTLSPDMQGAYCTFPASVLAPVPTHSTVSELSRSPVATATSC