You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IFI16
Gamma-interferon-inducible protein 16

Protein Summary
Description
Binds double-stranded DNA. Binds preferentially to supercoiled DNA and cruciform DNA structures. Seems to be involved in transcriptional regulation. May function as a transcriptional repressor. Could have a role in the regulation of hematopoietic differentiation through activation of unknown target genes. Controls cellular proliferation by modulating the functions of cell cycle regulatory factors including p53/TP53 and the retinoblastoma protein. May be involved in TP53-mediated transcriptional activation by enhancing TP53 sequence-specific DNA binding and modulating TP53 phosphorylation status. Seems to be involved in energy-level-dependent activation of the ATM/ AMPK/TP53 pathway coupled to regulation of autophagy. May be involved in regulation of TP53-mediated cell death also involving BRCA1. May be involved in the senescence of prostate epithelial cells. Involved in innate immune response by recognizing viral dsDNA in the cytosol and probably in the nucleus. After binding to viral ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000295809
  • ENSP00000295809
  • ENSG00000163565
  • ENST00000359709
  • ENSP00000352740
  • ENST00000368131
  • ENSP00000357113
  • ENST00000368132
  • ENSP00000357114
  • ENST00000448393
  • ENSP00000404325

Symbol
  • IFNGIP1
  • PYHIN2
  • IFNGIP1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
virus perturbation
1
biological process
0.99
kinase perturbation
0.99
disease perturbation
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 129.8   (req: < 5)
Gene RIFs: 106   (req: <= 3)
Antibodies: 306   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 129.8   (req: >= 5)
Gene RIFs: 106   (req: > 3)
Antibodies: 306   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 32
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (91)
Cytosolic sensors of pathogen-associated DNA (R-HSA-1834949)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytosolic sensors of pathogen-associated DNA
Reactome
IRF3-mediated induction of type I IFN
Reactome
Immune System
Reactome
Innate Immune System
Reactome
STING mediated induction of host immune responses
Name
Explore in Pharos
Explore in Source
Cytosolic sensors of pathogen-associated DNA
IRF3-mediated induction of type I IFN
Immune System
Innate Immune System
STING mediated induction of host immune responses
Gene Ontology Terms (38)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (87)
1 – 10 of 87
TMEM173
Tchem
Novelty: 0.00361815
Score: 0.978
Data Source: STRINGDB
IRF3
Tbio
Family: TF
Novelty: 0.00132895
Score: 0.966
Data Source: STRINGDB
TBK1
Tchem
Family: Kinase
Novelty: 0.00150228
Score: 0.965
Data Source: STRINGDB
DDX41
Tbio
Family: Enzyme
Novelty: 0.00021331
Score: 0.959
Data Source: STRINGDB
PYCARD
Tbio
Novelty: 0.00561282
Score: 0.944
Data Source: STRINGDB
CGAS
Tbio
Family: Enzyme
Novelty: 0.00176488
Score: 0.89
Data Source: STRINGDB
AIM2
Tbio
Novelty: 0.00325294
Score: 0.842
Data Source: STRINGDB
CASP1
Tchem
Family: Enzyme
Novelty: 0.00043112
Score: 0.838
Data Source: STRINGDB
DDX58
Tbio
Family: Enzyme
Novelty: 0.00108351
Score: 0.833
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.779
Data Source: STRINGDB
Publication Statistics
PubMed Score  129.80

PubMed score by year
PubTator Score  131.5

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFE
1-70
DIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPK
70-140
GSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVLQKRPVIVKVL
140-210
STTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVS
210-280
EAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQ
280-350
CHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTT
350-420
FPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPS
420-490
TPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTLKPRL
490-560
KTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKII
560-630
AIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRG
630-700
EFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDI
700-770
LNPDSSMETSPDFFF
770-785
MGKKYKNIVLLKGLEVINDYHFRMVKSLLSNDLKLNLKMREEYDKIQIADLMEEKFRGDAGLGKLIKIFEDIPTLEDLAETLKKEKLKVKGPALSRKRKKEVDATSPAPSTSSTVKTEGAEATPGAQKRKKSTKEKAGPKGSKVSEEQTQPPSPAGAGMSTAMGRSPSPKTSLSAPPNSSSTENPKTVAKCQVTPRRNVLQKRPVIVKVLSTTKPFEYETPEMEKKIMFHATVATQTQFFHVKVLNTSLKEKFNGKKIIIISDYLEYDSLLEVNEESTVSEAGPNQTFEVPNKIINRAKETLKIDILHKQASGNIVYGVFMLHKKTVNQKTTIYEIQDDRGKMDVVGTGQCHNIPCEEGDKLQLFCFRLRKKNQMSKLISEMHSFIQIKKKTNPRNNDPKSMKLPQEQRQLPYPSEASTTFPESHLRTPQMPPTTPSSSFFTKKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTKSEDTISKMNDFMRMQILKEGSHFPGPFMTSIGPAESHPHTPQMPPSTPSSSFLTTLKPRLKTEPEEVSIEDSAQSDLKEVMVLNATESFVYEPKEQKKMFHATVATENEVFRVKVFNIDLKEKFTPKKIIAIANYVCRNGFLEVYPFTLVADVNADRNMEIPKGLIRSASVTPKINQLCSQTKGSFVNGVFEVHKKNVRGEFTYYEIQDNTGKMEVVVHGRLTTINCEEGDKLKLTCFELAPKSGNTGELRSVIHSHIKVIKTRKNKKDILNPDSSMETSPDFFF