You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DPYSL2
Dihydropyrimidinase-related protein 2

Protein Summary
Description
Plays a role in neuronal development and polarity, as well as in axon growth and guidance, neuronal growth cone collapse and cell migration. Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. May play a role in endocytosis. This gene encodes a member of the collapsin response mediator protein family. Collapsin response mediator proteins form homo- and hetero-tetramers and facilitate neuron guidance, growth and polarity. The encoded protein promotes microtubule assembly and is required for Sema3A-mediated growth cone collapse, and also plays a role in synaptic signaling through interactions with calcium channels. This gene has been implicated in multiple neurological disorders, and hyperphosphorylation of the encoded protein may play a key role in the development of Alzheimer's disease. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000311151
  • ENSP00000309539
  • ENSG00000092964
  • ENST00000523027
  • ENSP00000431117

Symbol
  • CRMP2
  • ULIP2
  • DRP2
  • N2A3
  • CRMP2
  • DRP-2
  • ULIP2
  • CRMP-2
  • DHPRP2
  • ULIP-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase
0.96
PubMedID
0.94
virus perturbation
0.94
kinase perturbation
0.93
cellular component
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 262.88   (req: < 5)
Gene RIFs: 50   (req: <= 3)
Antibodies: 534   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 262.88   (req: >= 5)
Gene RIFs: 50   (req: > 3)
Antibodies: 534   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (538)
Axon guidance (R-HSA-422475)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Axon guidance
Reactome
CRMPs in Sema3A signaling
Reactome
Developmental Biology
Reactome
L1CAM interactions
Reactome
Recycling pathway of L1
Name
Explore in Pharos
Explore in Source
Axon guidance
CRMPs in Sema3A signaling
Developmental Biology
L1CAM interactions
Recycling pathway of L1
Protein-Protein Interactions (125)
1 – 10 of 125
DPYSL3
Tbio
Family: Enzyme
Novelty: 0.01191309
p_int: 0.999999964
p_ni: 3.6e-8
Score: 0.999
Data Source: BioPlex,STRINGDB
DPYSL5
Tbio
Family: Enzyme
Novelty: 0.0088639
p_int: 0.999995026
p_ni: 0.000004974
Score: 0.986
Data Source: BioPlex,STRINGDB
DPYS
Tbio
Family: Enzyme
Novelty: 0.01502718
p_int: 0.999950103
p_ni: 0.000049897
Score: 0.853
Data Source: BioPlex,STRINGDB
DPYSL4
Tbio
Family: Enzyme
Novelty: 0.05644394
p_int: 0.999387081
p_ni: 0.000612919
Score: 0.916
Data Source: BioPlex,STRINGDB
NUFIP1
Tbio
Novelty: 0.14861119
p_int: 0.996383013
p_ni: 0.003616987
Data Source: BioPlex
WDR83
Tbio
Novelty: 0.06422509
p_int: 0.995993515
p_ni: 0.004006485
Data Source: BioPlex
FAM19A3
Tdark
Novelty: 0.43478261
p_int: 0.993273609
p_ni: 0.006726391
Data Source: BioPlex
LGALS7
Tbio
Novelty: 0.00155211
p_int: 0.991011856
p_ni: 0.008988144
Score: 0.19
Data Source: BioPlex,STRINGDB
HAX1
Tbio
Novelty: 0.00851075
p_int: 0.988875595
p_ni: 0.011124405
Score: 0.177
Data Source: BioPlex,STRINGDB
SPSB3
Tdark
Novelty: 0.10003206
p_int: 0.98650005
p_ni: 0.01349995
Data Source: BioPlex
Publication Statistics
PubMed Score  262.88

PubMed score by year
PubTator Score  119.68

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGI
1-70
DVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVD
70-140
ISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQ
140-210
RILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPIT
210-280
ASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTL
280-350
IPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTI
350-420
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE
420-490
LRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVA
490-560
PPGGRANITSLG
560-572
MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFSLSGAQIDDNIPRRTTQRIVAPPGGRANITSLG