You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
INA
Alpha-internexin

Protein Summary
Description
Class-IV neuronal intermediate filament that is able to self-assemble. It is involved in the morphogenesis of neurons. It may form an independent structural network without the involvement of other neurofilaments or it may cooperate with NF-L to form the filamentous backbone to which NF-M and NF-H attach to form the cross-bridges. Neurofilaments are type IV intermediate filament heteropolymers composed of light, medium, and heavy chains. Neurofilaments comprise the axoskeleton and they functionally maintain the neuronal caliber. They may also play a role in intracellular transport to axons and dendrites. This gene is a member of the intermediate filament family and is involved in the morphogenesis of neurons. [provided by RefSeq, Jun 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000369849
  • ENSP00000358865
  • ENSG00000148798

Symbol
  • NEF5
  • NEF5
  • NF-66
  • TXBP-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.88
PubMedID
0.82
gene perturbation
0.71
cellular component
0.7
tissue sample
0.69


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 100.98   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 444   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 100.98   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 444   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (53)
1 – 10 of 53
NEFM
Tbio
Novelty: 0.00286577
p_int: 0.999999748
p_ni: 2.52e-7
Score: 0.83
Data Source: BioPlex,STRINGDB
VIM
Tbio
Novelty: 0.00046589
p_int: 0.999996709
p_ni: 0.000003291
Score: 0.817
Data Source: BioPlex,STRINGDB
SYNC
Tbio
Novelty: 0.0425174
p_int: 0.999993008
p_ni: 0.000006992
Score: 0.311
Data Source: BioPlex,STRINGDB
CCDC120
Tbio
Novelty: 0.71428571
p_int: 0.999968325
p_ni: 0.000031675
Data Source: BioPlex
RSPRY1
Tdark
Novelty: 0.46153846
p_int: 0.999964273
p_ni: 0.000035727
Score: 0.215
Data Source: BioPlex,STRINGDB
NEFH
Tbio
Novelty: 0.00161404
p_int: 0.999937342
p_ni: 0.000062658
Score: 0.4
Data Source: BioPlex,STRINGDB
MAP7
Tbio
Novelty: 0.02738196
p_int: 0.999729913
p_ni: 0.000270079
p_wrong: 8e-9
Data Source: BioPlex
GFAP
Tbio
Novelty: 0.00029784
p_int: 0.999717474
p_ni: 0.000282526
Score: 0.692
Data Source: BioPlex,STRINGDB
MIPEP
Tbio
Family: Enzyme
Novelty: 0.02165125
p_int: 0.998265147
p_ni: 0.001734853
Data Source: BioPlex
CCDC183
Tdark
p_int: 0.994619905
p_ni: 0.005380092
p_wrong: 3e-9
Data Source: BioPlex
Publication Statistics
PubMed Score  100.98

PubMed score by year
PubTator Score  263.69

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPP
1-70
ASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVG
70-140
ELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLAR
140-210
LDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNL
210-280
QSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAE
280-350
VAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPL
350-420
PNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIE
420-490
ETTISSQKI
490-499
MSFGSEHYLCSSSSYRKVFGDGSRLSARLSGAGGAGGFRSQSLSRSNVASSAACSSASSLGLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNRALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARSQALLERDGLAEEVQRLRARCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLATLQASSQAAAEVDVTVAKPDLTSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAARSTEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVAGYQDSIGQLENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPLPNPSYLLPPRILSATTSKVSSTGLSLKKEEEEEEASKVASKKTSQIGESFEEILEETVISTKKTEKSNIEETTISSQKI