You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SNCB
Beta-synuclein

Protein Summary
Description
Non-amyloid component of senile plaques found in Alzheimer disease. Could act as a regulator of SNCA aggregation process. Protects neurons from staurosporine and 6-hydroxy dopamine (6OHDA)-stimulated caspase activation in a p53/TP53-dependent manner. Contributes to restore the SNCA anti-apoptotic function abolished by 6OHDA. Not found in the Lewy bodies associated with Parkinson disease. This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000310112
  • ENSP00000308057
  • ENSG00000074317
  • ENST00000393693
  • ENSP00000377296
  • ENST00000506696
  • ENSP00000422223
  • ENST00000510387
  • ENSP00000424073
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.74
cellular component
0.69
kinase
0.67
cell type or tissue
0.65
histone modification site profile
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 110.55   (req: < 5)
Gene RIFs: 38   (req: <= 3)
Antibodies: 346   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 110.55   (req: >= 5)
Gene RIFs: 38   (req: > 3)
Antibodies: 346   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Cellular responses to external stimuli (R-HSA-8953897)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cellular responses to external stimuli
Reactome
MTF1 activates gene expression
Reactome
Response to metal ions
Name
Explore in Pharos
Explore in Source
Cellular responses to external stimuli
MTF1 activates gene expression
Response to metal ions
Protein-Protein Interactions (188)
1 – 10 of 188
NUFIP1
Tbio
Novelty: 0.14861119
p_int: 0.997939094
p_ni: 0.000364018
p_wrong: 0.001696888
Data Source: BioPlex
DNAAF2
Tbio
Novelty: 0.04657397
p_int: 0.997939094
p_ni: 0.000364018
p_wrong: 0.001696888
Data Source: BioPlex
DGUOK
Tbio
Family: Kinase
Novelty: 0.00695477
p_int: 0.997924975
p_ni: 0.000333936
p_wrong: 0.001741089
Data Source: BioPlex
ARMC1
Tbio
Novelty: 0.02013423
p_int: 0.983720956
p_ni: 0.014839848
p_wrong: 0.001439196
Score: 0.19
Data Source: BioPlex,STRINGDB
MTF1
Tbio
Family: TF
Novelty: 0.01143388
Score: 0.9
Data Source: STRINGDB
RAB3A
Tbio
Family: Enzyme
Novelty: 0.00506015
Score: 0.727
Data Source: STRINGDB
UNC5A
Tbio
Novelty: 0.05365755
Score: 0.698
Data Source: STRINGDB
TMEM263
Tdark
Novelty: 1.55555556
Score: 0.687
Data Source: STRINGDB
TSACC
Tbio
Novelty: 5
Score: 0.684
Data Source: STRINGDB
SNAP25
Tclin
Novelty: 0.0020914
Score: 0.67
Data Source: STRINGDB
Publication Statistics
PubMed Score  110.55

PubMed score by year
PubTator Score  76.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAV
1-70
FSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA
70-134
MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEA