You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SLC14A2
Urea transporter 2

Protein Summary
Description
Specialized low-affinity vasopressin-regulated urea transporter. Mediates rapid transepithelial urea transport across the inner medullary collecting duct and plays a major role in the urinary concentrating mechanism. The protein encoded by this gene belongs to the urea transporter family. In mammalian cells, urea is the chief end product of nitrogen catabolism, and plays an important role in the urinary concentration mechanism. This protein is expressed in the inner medulla of the kidney, and mediates rapid transepithelial urea transport across the inner medullary collecting duct. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000255226
  • ENSP00000255226
  • ENSG00000132874
  • ENST00000586448
  • ENSP00000465953
  • ENST00000642891
  • ENSP00000494834
  • ENSG00000285096
  • ENST00000643366
  • ENSP00000494573

Symbol
  • HUT2
  • UT2
  • UT2
  • UTA
  • UTR
  • HUT2
  • UT-A2
  • hUT-A6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
1
phenotype
0.74
cell type or tissue
0.73
co-expressed gene
0.65
disease
0.64


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.33   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 67   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 44.33   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 67   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
SLC-mediated transmembrane transport (R-HSA-425407)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of bile salts and organic acids, metal ions and amine compounds
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
SLC-mediated transmembrane transport
Transport of bile salts and organic acids, metal ions and amine compounds
Transport of small molecules
Protein-Protein Interactions (58)
1 – 10 of 58
PKP2
Tbio
Novelty: 0.00658515
p_int: 0.92213126
p_ni: 0.07786874
Score: 0.403
Data Source: BioPlex,STRINGDB
AQP2
Tbio
Novelty: 0.00105362
Score: 0.784
Data Source: STRINGDB
REN
Tclin
Family: Enzyme
Novelty: 0.00002857
Score: 0.673
Data Source: STRINGDB
SLC12A1
Tclin
Family: Transporter
Novelty: 0.00394411
Score: 0.668
Data Source: STRINGDB
AVP
Tbio
Novelty: 0.0001163
Score: 0.664
Data Source: STRINGDB
ELP1
Tbio
Novelty: 0.00109618
Score: 0.626
Data Source: STRINGDB
MSH5
Tbio
Novelty: 0.0141649
Score: 0.621
Data Source: STRINGDB
ALKAL2
Tbio
Novelty: 0.03836838
Score: 0.601
Data Source: STRINGDB
DIS3L
Tdark
Family: Enzyme
Novelty: 0.23668639
Score: 0.584
Data Source: STRINGDB
AQP1
Tbio
Novelty: 0.000781
Score: 0.583
Data Source: STRINGDB
Publication Statistics
PubMed Score  44.33

PubMed score by year
PubTator Score  78.61

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSDPHSSPLLPEPLSSRYKLYEAEFTSPSWPSTSPDTHPALPLLEMPEEKDLRSSNEDSHIVKIEKLNER
1-70
SKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQVMFINNPLSGLI
70-140
IFIGLLIQNPWWTITGGLGTVVSTLTALALGQDRSAIASGLHGYNGMLVGLLMAVFSEKLDYYWWLLFPV
140-210
TFTAMSCPVLSSALNSIFSKWDLPVFTLPFNIAVTLYLAATGHYNLFFPTTLVEPVSSVPNITWTEMEMP
210-280
LLLQAIPVGVGQVYGCDNPWTGGVFLVALFISSPLICLHAAIGSIVGLLAALSVATPFETIYTGLWSYNC
280-350
VLSCIAIGGMFYALTWQTHLLALICALFCAYMEAAISNIMSVVGVPPGTWAFCLATIIFLLLTTNNPAIF
350-420
RLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRS
420-490
KVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYI
490-560
TGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSGILIILGLFIQNPWWAISGCLGTIMSTLTAL
560-630
ILSQDKSAIAAGFHGYNGVLVGLLMAVFSDKGDYYWWLLLPVIIMSMSCPILSSALGTIFSKWDLPVFTL
630-700
PFNITVTLYLAATGHYNLFFPTTLLQPASAMPNITWSEVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLIA
700-770
LFISSPLICLHAAIGSTMGMLAALTIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALF
770-840
AAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPAIYKLPLSKVTYPEANRIYYLSQERNRRASI
840-910
ITKYQAYDVS
910-920
MSDPHSSPLLPEPLSSRYKLYEAEFTSPSWPSTSPDTHPALPLLEMPEEKDLRSSNEDSHIVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFIDWVLRGTAQVMFINNPLSGLIIFIGLLIQNPWWTITGGLGTVVSTLTALALGQDRSAIASGLHGYNGMLVGLLMAVFSEKLDYYWWLLFPVTFTAMSCPVLSSALNSIFSKWDLPVFTLPFNIAVTLYLAATGHYNLFFPTTLVEPVSSVPNITWTEMEMPLLLQAIPVGVGQVYGCDNPWTGGVFLVALFISSPLICLHAAIGSIVGLLAALSVATPFETIYTGLWSYNCVLSCIAIGGMFYALTWQTHLLALICALFCAYMEAAISNIMSVVGVPPGTWAFCLATIIFLLLTTNNPAIFRLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFHIEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTSWIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSGILIILGLFIQNPWWAISGCLGTIMSTLTALILSQDKSAIAAGFHGYNGVLVGLLMAVFSDKGDYYWWLLLPVIIMSMSCPILSSALGTIFSKWDLPVFTLPFNITVTLYLAATGHYNLFFPTTLLQPASAMPNITWSEVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLIALFISSPLICLHAAIGSTMGMLAALTIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALFAAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPAIYKLPLSKVTYPEANRIYYLSQERNRRASIITKYQAYDVS