You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
CHRNA6
Neuronal acetylcholine receptor subunit alpha-6

Protein Classes
Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene encodes an alpha subunit of neuronal nicotinic acetylcholine receptors. These receptors consist of five subunits and function as ion channels involved in neurotransmission. The encoded protein is a subunit of neuronal nicotinic acetylcholine receptors that mediate dopaminergic neurotransmission and are activated by acetylcholine and exogenous nicotine. Alternatively spliced transcript variants have been observed for this gene. Single nucleotide polymorphisms in this gene have been associated with both nicotine and alcohol dependence. [provided by RefSeq, Dec 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000276410
  • ENSP00000276410
  • ENSG00000147434
  • ENST00000534622
  • ENSP00000433871

Symbol
  • CHNRA6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
molecular function
0.84
cell line
0.62
transcription factor perturbation
0.54
small molecule perturbation
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.76   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 134   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.76   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 134   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 2
Active Ligands (1)
1 – 1 of 1
hexamethonium
chemical structure image
Pathways (14)
Acetylcholine binding and downstream events (R-HSA-181431)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine binding and downstream events
Reactome
Highly calcium permeable nicotinic acetylcholine receptors
Reactome
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Name
Explore in Pharos
Explore in Source
Acetylcholine binding and downstream events
Highly calcium permeable nicotinic acetylcholine receptors
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Protein-Protein Interactions (53)
1 – 10 of 53
CHRNB4
Tclin
Family: IC
Novelty: 0.02388015
Score: 0.933
Data Source: Reactome,STRINGDB
CHRNB2
Tclin
Family: IC
Novelty: 0.02119739
Score: 0.932
Data Source: STRINGDB
CHRNA5
Tbio
Family: IC
Novelty: 0.0060853
Score: 0.929
Data Source: STRINGDB
CHRNA7
Tchem
Family: IC
Novelty: 0.00717396
Score: 0.924
Data Source: STRINGDB
CHRNB3
Tchem
Family: IC
Novelty: 0.04622453
Score: 0.914
Data Source: Reactome,STRINGDB
CHRNA9
Tchem
Family: IC
Novelty: 0.07858477
Score: 0.907
Data Source: STRINGDB
CHRNA4
Tclin
Family: IC
Novelty: 0.00260286
Score: 0.906
Data Source: Reactome,STRINGDB
CHRNA2
Tchem
Family: IC
Novelty: 0.03966016
Score: 0.905
Data Source: STRINGDB
CHRNA3
Tclin
Family: IC
Novelty: 0.00918226
Score: 0.904
Data Source: STRINGDB
CHRNA1
Tclin
Family: IC
Novelty: 0.01910227
Score: 0.903
Data Source: STRINGDB
Publication Statistics
PubMed Score  16.76

PubMed score by year
PubTator Score  13.42

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQL
1-70
ANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALL
70-140
KYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIID
140-210
ASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLL
210-280
SLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLP
280-350
QVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVV
350-420
ENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGN
420-490
TGKS
490-494
MLTSKGQGFLHGGLCLWLCVFTPFFKGCVGCATEERLFHKLFSHYNQFIRPVENVSDPVTVHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPMEYDGIETLRVPADKIWKPDIVLYNNAVGDFQVEGKTKALLKYNGMITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIIDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVVPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPTTHTMPRWVKTVFLKLLPQVLLMRWPLDKTRGTGSDAVPRGLARRPAKGKLASHGEPRHLKECFHCHKSNELATSKRRLSHQPLQWVVENSEHSPEVEDVINSVQFIAENMKSHNETKEVEDDWKYVAMVVDRVFLWVFIIVCVFGTAGLFLQPLLGNTGKS