You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
SLC1A5
Neutral amino acid transporter B(0)

Protein Summary
Description
Sodium-dependent amino acids transporter that has a broad substrate specificity, with a preference for zwitterionic amino acids. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated, anionic, and cationic amino acids (PubMed:8702519, PubMed:29872227). Through binding of the fusogenic protein syncytin-1/ERVW-1 may mediate trophoblasts syncytialization, the spontaneous fusion of their plasma membranes, an essential process in placental development (PubMed:10708449, PubMed:23492904). (Microbial infection) Acts as a cell surface receptor for Feline endogenous virus RD114. (Microbial infection) Acts as a cell surface receptor for Baboon M7 endogenous virus. (Microbial infection) Acts as a cell surface receptor for type D simian retroviruses. The SLC1A5 gene encodes a sodium-dependent neutral amino acid transporter that can act as a receptor for RD114/type D retrovirus (Larriba et al., 2001 [Pu ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000412532
  • ENSP00000397924
  • ENSG00000105281
  • ENST00000434726
  • ENSP00000406532
  • ENST00000542575
  • ENSP00000444408

Symbol
  • ASCT2
  • M7V1
  • RDR
  • RDRC
  • R16
  • AAAT
  • ATBO
  • M7V1
  • RDRC
  • ASCT2
  • M7VS1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.97
interacting protein
0.95
transcription factor binding site profile
0.92
transcription factor perturbation
0.88
PubMedID
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 420.47   (req: < 5)
Gene RIFs: 61   (req: <= 3)
Antibodies: 249   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 420.47   (req: >= 5)
Gene RIFs: 61   (req: > 3)
Antibodies: 249   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Amino acid transport across the plasma membrane (R-HSA-352230)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amino acid transport across the plasma membrane
Reactome
SLC-mediated transmembrane transport
Reactome
Transport of inorganic cations/anions and amino acids/oligopeptides
Reactome
Transport of small molecules
Name
Explore in Pharos
Explore in Source
Amino acid transport across the plasma membrane
SLC-mediated transmembrane transport
Transport of inorganic cations/anions and amino acids/oligopeptides
Transport of small molecules
Gene Ontology Terms (20)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (101)
1 – 10 of 101
SLC25A24
Tbio
Family: Transporter
Novelty: 0.09884975
p_int: 0.99829112
p_ni: 0.001708846
p_wrong: 3.4e-8
Score: 0.186
Data Source: BioPlex,STRINGDB
HSD17B7
Tchem
Family: Enzyme
Novelty: 0.0605734
p_int: 0.985857961
p_ni: 0.014142039
Score: 0.165
Data Source: BioPlex,STRINGDB
GPR89A
Tdark
Family: IC
Novelty: 0.13236179
p_int: 0.967336778
p_ni: 0.032663213
p_wrong: 1e-8
Data Source: BioPlex
ATP9A
Tbio
Family: Transporter
Novelty: 0.30295744
p_int: 0.943753807
p_ni: 0.056239579
p_wrong: 0.000006614
Data Source: BioPlex
ALG5
Tbio
Family: Enzyme
Novelty: 0.08726413
p_int: 0.931895236
p_ni: 0.068104764
Score: 0.158
Data Source: BioPlex,STRINGDB
SLC25A46
Tbio
Family: Transporter
Novelty: 0.04548316
p_int: 0.925202139
p_ni: 0.074783002
p_wrong: 0.000014859
Data Source: BioPlex
ZDHHC18
Tdark
Family: Enzyme
Novelty: 1.62162162
p_int: 0.914849509
p_ni: 0.063435941
p_wrong: 0.02171455
Data Source: BioPlex
CD47
Tchem
Novelty: 0.00158939
p_int: 0.90250029
p_ni: 0.097498977
p_wrong: 7.33e-7
Score: 0.207
Data Source: BioPlex,STRINGDB
SERINC1
Tbio
Novelty: 0.03211582
p_int: 0.842275167
p_ni: 0.157724833
Score: 0.227
Data Source: BioPlex,STRINGDB
HACD2
Tbio
Family: Enzyme
Novelty: 0.4
p_int: 0.833814015
p_ni: 0.166181911
p_wrong: 0.000004074
Data Source: BioPlex
Publication Statistics
PubMed Score  420.47

PubMed score by year
PubTator Score  209.59

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGL
1-70
GVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTL
70-140
LASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEE
140-210
RNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVG
210-280
IMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGT
280-350
SSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVT
350-420
ATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTE
420-490
SRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM
490-541
MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVVAVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLDPGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIVFGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFARLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLMMKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVTATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAGLLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESVM