You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ELAVL1
ELAV-like protein 1

Protein Summary
Description
RNA-binding protein that binds to the 3'-UTR region of mRNAs and increases their stability (PubMed:14517288, PubMed:18285462). Involved in embryonic stem cells (ESCs) differentiation: preferentially binds mRNAs that are not methylated by N6-methyladenosine (m6A), stabilizing them, promoting ESCs differentiation (By similarity). Binds to poly-U elements and AU-rich elements (AREs) in the 3'-UTR of target mRNAs (PubMed:8626503, PubMed:17632515, PubMed:18285462, PubMed:23519412, PubMed:14731398). Binds avidly to the AU-rich element in FOS and IL3/interleukin-3 mRNAs. In the case of the FOS AU-rich element, binds to a core element of 27 nucleotides that contain AUUUA, AUUUUA, and AUUUUUA motifs. Binds preferentially to the 5'-UUUU[AG]UUU-3' motif in vitro (PubMed:8626503). With ZNF385A, binds the 3'-UTR of p53/TP53 mRNA to control their nuclear export induced by CDKN2A. Hence, may regulate p53/TP53 expression and mediate in part the CDKN2A anti-proliferative activity. May also bind with ZN ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000407627
  • ENSP00000385269
  • ENSG00000066044
  • ENST00000596459
  • ENSP00000472197

Symbol
  • HUR
  • HUR
  • Hua
  • MelG
  • ELAV1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
interacting protein
1
protein complex
0.99
hub protein
0.95
biological term
0.93


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 663.26   (req: < 5)
Gene RIFs: 356   (req: <= 3)
Antibodies: 433   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 663.26   (req: >= 5)
Gene RIFs: 356   (req: > 3)
Antibodies: 433   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (22)
HuR (ELAVL1) binds and stabilizes mRNA (R-HSA-450520)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
HuR (ELAVL1) binds and stabilizes mRNA
Reactome
Metabolism of RNA
Reactome
Processing of Capped Intron-Containing Pre-mRNA
Reactome
Regulation of mRNA stability by proteins that bind AU-rich elements
Reactome
mRNA Splicing
Name
Explore in Pharos
Explore in Source
HuR (ELAVL1) binds and stabilizes mRNA
Metabolism of RNA
Processing of Capped Intron-Containing Pre-mRNA
Regulation of mRNA stability by proteins that bind AU-rich elements
mRNA Splicing
Gene Ontology Terms (27)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (500)
1 – 10 of 500
PTBP1
Tbio
Novelty: 0.00204645
Score: 0.999
Data Source: STRINGDB
HNRNPK
Tbio
Novelty: 0.00343899
Score: 0.998
Data Source: STRINGDB
CDC5L
Tbio
Family: TF
Novelty: 0.00617757
Score: 0.998
Data Source: STRINGDB
HNRNPC
Tbio
Novelty: 0.00195495
Score: 0.998
Data Source: STRINGDB
SRSF1
Tbio
Novelty: 0.00119334
Score: 0.997
Data Source: STRINGDB
HNRNPH1
Tbio
Novelty: 0.01807307
Score: 0.997
Data Source: STRINGDB
TRA2B
Tbio
Novelty: 0.02179789
Score: 0.997
Data Source: STRINGDB
HNRNPA2B1
Tbio
Novelty: 0.00503583
Score: 0.997
Data Source: STRINGDB
HNRNPA1
Tchem
Novelty: 0.00262355
Score: 0.997
Data Source: STRINGDB
SRSF3
Tbio
Novelty: 0.0126411
Score: 0.997
Data Source: STRINGDB
Publication Statistics
PubMed Score  663.26

PubMed score by year
PubTator Score  507

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVT
1-70
AKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVD
70-140
QTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGP
140-210
VHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFN
210-280
TNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK
280-326
MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSYARPSSEVIKDANLYISGLPRTMTQKDVEDMFSRFGRIINSRVLVDQTTGLSRGVAFIRFDKRSEAEEAITSFNGHKPPGSSEPITVKFAANPNQNKNVALLSQLYHSPARRFGGPVHHQAQRFRFSPMGVDHMSGLSGVNVPGNASSGWCIFIYNLGQDADEGILWQMFGPFGAVTNVKVIRDFNTNKCKGFGFVTMTNYEEAAMAIASLNGYRLGDKILQVSFKTNKSHK