You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
DIXDC1
Dixin

Protein Summary
Description
Positive effector of the Wnt signaling pathway; activates WNT3A signaling via DVL2. Regulates JNK activation by AXIN1 and DVL2. The protein encoded by this gene is a positive regulator of the Wnt signaling pathway. The encoded protein is found associated with gamma tubulin at the centrosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000440460
  • ENSP00000394352
  • ENSG00000150764
  • ENST00000529225
  • ENSP00000434130
  • ENST00000615255
  • ENSP00000480808

Symbol
  • CCD1
  • KIAA1735
  • CCD1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
virus perturbation
0.98
transcription factor perturbation
0.84
transcription factor
0.79
biological process
0.74
protein domain
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 21.71   (req: < 5)
Gene RIFs: 23   (req: <= 3)
Antibodies: 175   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 21.71   (req: >= 5)
Gene RIFs: 23   (req: > 3)
Antibodies: 175   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 10
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (13)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (31)
1 – 10 of 31
NDEL1
Tbio
Novelty: 0.01425912
p_int: 1
Score: 0.636
Data Source: BioPlex,STRINGDB
FAM124A
Tdark
Novelty: 3.33333333
p_int: 0.999999884
p_ni: 1.15e-7
p_wrong: 1e-9
Data Source: BioPlex
BRK1
Tbio
Novelty: 0.03479369
p_int: 0.999998047
p_ni: 0.000001945
p_wrong: 8e-9
Data Source: BioPlex
FBLIM1
Tbio
Novelty: 0.04280121
p_int: 0.999993625
p_ni: 0.000006275
p_wrong: 1e-7
Data Source: BioPlex
L3HYPDH
Tdark
Family: Enzyme
Novelty: 0.33333333
p_int: 0.999971131
p_ni: 0.000028869
Score: 0.282
Data Source: BioPlex,STRINGDB
MAP3K4
Tbio
Family: Kinase
Novelty: 0.02920916
Score: 0.763
Data Source: STRINGDB
DISC1
Tbio
Novelty: 0.00165188
Score: 0.754
Data Source: STRINGDB
AXIN1
Tbio
Novelty: 0.00280253
Score: 0.73
Data Source: STRINGDB
CDK5
Tchem
Family: Kinase
Novelty: 0.00081843
Score: 0.713
Data Source: STRINGDB
DLAT
Tbio
Family: Enzyme
Novelty: 0.00424045
Score: 0.712
Data Source: STRINGDB
Publication Statistics
PubMed Score  21.71

PubMed score by year
PubTator Score  28.45

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLIEIVAGEKLSG
1-70
VQLSPGNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVLALAAHFKPGSSRTVNQGRDS
70-140
RAPLQSHRPHCATAVAQGAAAALADVCHDMSRSGRDVFRYRQRNSSMDEEIENPYWSVRALVQQYEGQQR
140-210
SPSESSCSSLTSPSPIHSAKSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSW
210-280
EEQLLEQQEYLEKEMEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEEN
280-350
QDLKKELLKCKQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLL
350-420
GEYKKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDLERELEHKDVLLAHCMKREADEATNYNSHNSQS
420-490
NGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHVMETQKKQ
490-560
ERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDF
560-630
KAAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEEDHGEN
630-683
MLACLTRGNLLDVLQEGFNEQQLQAYVAWVNAQLKKRPAVKPVQDLRQDLRDGVILAYLIEIVAGEKLSGVQLSPGNQQEMKNNVEKVLQFVASKKIRMHQTSAKDIVDGNLKSIMRLVLALAAHFKPGSSRTVNQGRDSRAPLQSHRPHCATAVAQGAAAALADVCHDMSRSGRDVFRYRQRNSSMDEEIENPYWSVRALVQQYEGQQRSPSESSCSSLTSPSPIHSAKSESIITQSEEKADFVIIPAEGIENRTEGTDSPLSRDWRPGSPGTYLETSWEEQLLEQQEYLEKEMEEAKKMISGLQALLLNGSLPEDEQERPLALCEPGVNPEEQLIIIQSRLDQSMEENQDLKKELLKCKQEARNLQGIKDALQQRLTQQDTSVLQLKQELLRANMDKDELHNQNVDLQRKLDERNRLLGEYKKELGQKDRLLQQHQAKLEEALRKLSDVSYHQVDLERELEHKDVLLAHCMKREADEATNYNSHNSQSNGFLLPTAGKGATSVSNRGTSDLQLVRDALRSLRNSFSGHDPQHHTIDSLEQGISSLMERLHVMETQKKQERKVRVKSPRTQVGSEYRESWPPNSKLPHSQSSPTVSSTCTKVLYFTDRSLTPFMVNIPKRLEEVTLKDFKAAIDREGNHRYHFKALDPEFGTVKEEIFHDDDAIPGWEGKIVAWVEEDHGEN