You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
TESK1
Dual specificity testis-specific protein kinase 1

Protein Summary
Description
Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. Probably plays a central role at and after the meiotic phase of spermatogenesis (By similarity). This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and a C-terminal proline-rich domain. Its protein kinase domain is most closely related to those of the LIM motif-containing protein kinases (LIMKs). The encoded protein can phosphorylate myelin basic protein and histone in vitro. The testicular germ cell-specific expression and developmental pattern of expression of the mouse gene suggests that this gene plays an important role at and after the meiotic phase of spermatogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000336395
  • ENSP00000338127
  • ENSG00000107140
  • ENST00000620767
  • ENSP00000481045
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
histone modification site profile
0.92
protein domain
0.85
disease perturbation
0.83
transcription factor binding site profile
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.91   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 144   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 14.91   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 144   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 3
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (4)
Cell junction organization (R-HSA-446728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell junction organization
Reactome
Cell-Cell communication
Reactome
Cell-extracellular matrix interactions
Reactome
Regulation of cytoskeletal remodeling and cell spreading by IPP complex components
Name
Explore in Pharos
Explore in Source
Cell junction organization
Cell-Cell communication
Cell-extracellular matrix interactions
Regulation of cytoskeletal remodeling and cell spreading by IPP complex components
Gene Ontology Terms (17)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-EC
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (47)
1 – 10 of 47
RABEPK
Tdark
Novelty: 2.22222222
p_int: 0.999946812
p_ni: 1.1e-8
p_wrong: 0.000053177
Data Source: BioPlex
PARVA
Tbio
Novelty: 0.00412394
Score: 0.958
Data Source: Reactome,STRINGDB
SPRY4
Tbio
Novelty: 0.01980762
Score: 0.888
Data Source: STRINGDB
CFL1
Tbio
Novelty: 0.00066971
Score: 0.829
Data Source: STRINGDB
SPRED1
Tbio
Novelty: 0.0131778
Score: 0.813
Data Source: STRINGDB
SPRY2
Tbio
Novelty: 0.01058901
Score: 0.797
Data Source: STRINGDB
RUSC2
Tbio
Novelty: 0.14044143
Score: 0.744
Data Source: STRINGDB
NEURL3
Tdark
Family: Enzyme
Novelty: 0.25531915
Score: 0.744
Data Source: STRINGDB
YWHAB
Tchem
Novelty: 0.0080419
Score: 0.707
Data Source: STRINGDB
FOXL2
Tbio
Family: TF
Novelty: 0.00136796
Score: 0.692
Data Source: STRINGDB
Publication Statistics
PubMed Score  14.91

PubMed score by year
PubTator Score  9.54

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSE
1-70
VYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQL
70-140
LSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGA
140-210
RKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGD
210-280
DCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDP
280-350
RLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVT
350-420
TPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAV
420-490
ATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPR
490-560
EPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS
560-626
MAGERPPLRGPGPGPGEVPGEGPPGPGGTGGGPGRGRPSSYRALRSAVSSLARVDDFHCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNKLPSNRGNTLREVQLMNRLRHPNILRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHSKGVFHRDLTSKNCLVRREDRGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGELYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVLPLVPPSPFPSTQLPLVTTPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPAVGPSAEEKMECEGSSPEPEPPGPAPQLPLAVATDNFISTCSSASQPWSPRSGPVLNNNPPAVVVNSPQGWAGEPWNRAQHSLPRAAALERTEPSPPPSAPREPDEGLPCPGCCLGPFSFGFLSMCPRPTPAVARYRNLNCEAGSLLCHRGHHAKPPTPSLQLPGARS