You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SF3B4
Splicing factor 3B subunit 4

Protein Summary
Description
Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex (PubMed:27720643). SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (PubMed:12234937). May also be involved in the assembly of the 'E' complex. SF3B4 has been found in complex 'B' and 'C' as well (PubMed:10882114). Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron (PubMed:15146077). This gene encodes one of four subunits of the splicing factor 3B. The protein encoded by this gene cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-bi ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000271628
  • ENSP00000271628
  • ENSG00000143368

Symbol
  • SAP49
  • AFD1
  • Hsh49
  • SAP49
  • SF3b49
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.69
hub protein
0.67
transcription factor binding site profile
0.66
gene perturbation
0.65
protein complex
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.06   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 288   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.06   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 288   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (7)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
Processing of Capped Intron-Containing Pre-mRNA
Reactome
mRNA Splicing
Reactome
mRNA Splicing - Major Pathway
Reactome
mRNA Splicing - Minor Pathway
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
Processing of Capped Intron-Containing Pre-mRNA
mRNA Splicing
mRNA Splicing - Major Pathway
mRNA Splicing - Minor Pathway
Gene Ontology Terms (11)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Protein-Protein Interactions (277)
1 – 10 of 277
PHF5A
Tbio
Family: Epigenetic
Novelty: 0.00307327
p_int: 0.999610612
p_ni: 0.000389388
Score: 0.999
Data Source: BioPlex,STRINGDB
CCDC97
Tdark
Novelty: 7
p_int: 0.9987792
p_ni: 0.0012208
Score: 0.158
Data Source: BioPlex,STRINGDB
SNRPGP15
Tdark
p_int: 0.983911514
p_ni: 0.016088486
Data Source: BioPlex
SNRPA1
Tbio
Novelty: 0.02038744
p_int: 0.97935993
p_ni: 0.02064007
Score: 0.998
Data Source: BioPlex,STRINGDB
SNRPE
Tbio
Novelty: 0.00150118
p_int: 0.978791223
p_ni: 0.021208777
Score: 0.986
Data Source: BioPlex,STRINGDB
SNRPB
Tbio
Novelty: 0.01137048
p_int: 0.97737676
p_ni: 0.02262324
Score: 0.99
Data Source: BioPlex,STRINGDB
SNRPN
Tbio
Novelty: 0.00241221
p_int: 0.960442258
p_ni: 0.039557742
Score: 0.992
Data Source: BioPlex,STRINGDB
RRS1
Tbio
Novelty: 0.00929224
p_int: 0.911890215
p_ni: 0.088109785
Score: 0.198
Data Source: BioPlex,STRINGDB
SNRPF
Tdark
Novelty: 0.22699635
p_int: 0.85656778
p_ni: 0.14343222
Score: 0.983
Data Source: BioPlex,STRINGDB
SF3B1
Tbio
Novelty: 0.01930575
Score: 0.999
Data Source: STRINGDB
Publication Statistics
PubMed Score  32.06

PubMed score by year
PubTator Score  24.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYA
1-70
IKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGN
70-140
SKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQL
140-210
FADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGT
210-280
PGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMG
280-350
MPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRG
350-420
PLPQ
420-424
MAAGPISERNQDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVEFLSEEDADYAIKIMNMIKLYGKPIRVNKASAHNKNLDVGANIFIGNLDPEIDEKLLYDTFSAFGVILQTPKIMRDPDTGNSKGYAFINFASFDASDAAIEAMNGQYLCNRPITVSYAFKKDSKGERHGSAAERLLAAQNPLSQADRPHQLFADAPPPPSAPNPVVSSLGSGLPPPGMPPPGSFPPPVPPPGALPPGIPPAMPPPPMPPGAAGHGPPSAGTPGAGHPGHGHSHPHPFPPGGMPHPGMSQMQLAHHGPHGLGHPHAGPPGSGGQPPPRPPPGMPHPGPPPMGMPPRGPPFGSPMGHPGPMPPHGMRGPPPLMPPHGYTGPPRPPPYGYQRGPLPPPRPTPRPPVPPRGPLRGPLPQ