You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
RPS6KA1
Ribosomal protein S6 kinase alpha-1

Protein Summary
Description
Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1, which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal, acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. Phosphorylates RPS6 in response to serum or EGF via an mTOR-independent mechanism and promotes ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374168
  • ENSP00000363283
  • ENSG00000117676
  • ENST00000526792
  • ENSP00000431651
  • ENST00000530003
  • ENSP00000432281
  • ENST00000531382
  • ENSP00000435412
  • ENST00000628081
  • ENSP00000487553
  • ENSG00000281877
  • ENST00000628256
  • ENSP00000487349
  • ENST00000629832
  • ENSP00000486881
  • ENST00000631108
  • ENSP00000487166

Symbol
  • MAPKAPK1A
  • RSK1
  • RSK
  • HU-1
  • RSK1
  • p90Rsk
  • MAPKAPK1A
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
1
drug perturbation
0.99
interacting protein
0.99
virus perturbation
0.99
kinase perturbation
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 353.2   (req: < 5)
Gene RIFs: 73   (req: <= 3)
Antibodies: 1508   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 353.2   (req: >= 5)
Gene RIFs: 73   (req: > 3)
Antibodies: 1508   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 19
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 21
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (21)
1 – 10 of 21
CHEMBL388978
chemical structure image
CHEMBL603469
chemical structure image
CHEMBL3975634
chemical structure image
CHEMBL478629
chemical structure image
CHEMBL464552
chemical structure image
compound 33 [PMID: 19364658]
chemical structure image
BI-D1870
chemical structure image
CHEMBL375312
chemical structure image
prexasertib
chemical structure image
CHEMBL523523
chemical structure image
Protein Data Bank (17)
1 – 5 of 17
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (93)
Activation of NMDA receptors and postsynaptic events (R-HSA-442755)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 49
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of NMDA receptors and postsynaptic events
Reactome
Axon guidance
Reactome
CREB phosphorylation
Reactome
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
Reactome
Cellular Senescence
Name
Explore in Pharos
Explore in Source
Activation of NMDA receptors and postsynaptic events
Axon guidance
CREB phosphorylation
CREB1 phosphorylation through NMDA receptor-mediated activation of RAS signaling
Cellular Senescence
Gene Ontology Terms (22)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
MGI
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (163)
1 – 10 of 163
MISP
Tbio
Novelty: 0.01696113
p_int: 0.999998591
p_ni: 0.000001408
Score: 0.189
Data Source: BioPlex,STRINGDB
FYN
Tclin
Family: Kinase
Novelty: 0.00092113
p_int: 0.999995634
p_ni: 0.000004366
Score: 0.3
Data Source: BioPlex,STRINGDB
CTTN
Tbio
Novelty: 0.00214976
p_int: 0.999936605
p_ni: 0.000063395
Score: 0.16
Data Source: BioPlex,STRINGDB
IRGC
Tbio
Family: Enzyme
Novelty: 0.00185422
p_int: 0.999912714
p_ni: 0.000087056
p_wrong: 2.3e-7
Score: 0.189
Data Source: BioPlex,STRINGDB
CSNK2B
Tbio
Family: Kinase
Novelty: 0.00171173
p_int: 0.999705319
p_ni: 0.000294681
Score: 0.349
Data Source: BioPlex,STRINGDB
IL17RA
Tclin
Novelty: 0.00599602
p_int: 0.999671837
p_ni: 0.000314338
p_wrong: 0.000013825
Score: 0.169
Data Source: BioPlex,STRINGDB
FGFR2
Tclin
Family: Kinase
Novelty: 0.00077461
p_int: 0.999312808
p_ni: 0.000687183
p_wrong: 9e-9
Score: 0.234
Data Source: BioPlex,STRINGDB
PAPOLG
Tbio
Family: Enzyme
Novelty: 0.01006121
p_int: 0.998218185
p_ni: 0.001781815
Data Source: BioPlex
FAM136A
Tdark
Novelty: 0.43298969
p_int: 0.996178284
p_ni: 0.003585191
p_wrong: 0.000236525
Data Source: BioPlex
RAB27A
Tchem
Family: Enzyme
Novelty: 0.00463277
p_int: 0.989674122
p_ni: 0.010325877
Data Source: BioPlex
Publication Statistics
PubMed Score  353.20

PubMed score by year
PubTator Score  164.39

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQ
1-70
GSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLI
70-140
LDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSK
140-210
EAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLG
210-280
MPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFY
280-350
FDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVV
350-420
KETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTE
420-490
LMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGF
490-560
AKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIG
560-630
SGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAA
630-700
TYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
700-735
MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKMERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYFDTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRAPQAPLHSVVQQLHGKNLVFSDGYVVKETIGVGSYSECKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPNIITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTIGKTVEYLHSQGVVHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWNTVSETAKDLVSKMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL