You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CNN3
Calponin-3

Protein Summary
Description
Thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity. This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000370206
  • ENSP00000359225
  • ENSG00000117519
  • ENST00000394202
  • ENSP00000377752
  • ENST00000545882
  • ENSP00000440081
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
PubMedID
0.89
disease perturbation
0.83
transcription factor binding site profile
0.77
interacting protein
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.62   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 205   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 19.62   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 205   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (51)
1 – 10 of 51
CNN2
Tbio
Novelty: 0.06148819
p_int: 1
Score: 0.529
Data Source: BioPlex,STRINGDB
CARM1
Tchem
Family: Epigenetic
Novelty: 0.0078817
p_int: 0.851472364
p_ni: 0.148527636
Score: 0.261
Data Source: BioPlex,STRINGDB
CALD1
Tbio
Novelty: 0.00107425
Score: 0.754
Data Source: STRINGDB
SMTN
Tbio
Novelty: 0.00823973
Score: 0.687
Data Source: STRINGDB
UTRN
Tbio
Novelty: 0.00225431
Score: 0.665
Data Source: STRINGDB
PLS3
Tbio
Novelty: 0.01113879
Score: 0.664
Data Source: STRINGDB
MYH11
Tbio
Novelty: 0.00189652
Score: 0.636
Data Source: STRINGDB
PLS1
Tbio
Novelty: 0.0040352
Score: 0.62
Data Source: STRINGDB
MYOCD
Tbio
Novelty: 0.00397684
Score: 0.594
Data Source: STRINGDB
EHBP1
Tbio
Novelty: 0.1059361
Score: 0.593
Data Source: STRINGDB
Publication Statistics
PubMed Score  19.62

PubMed score by year
PubTator Score  15.61

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSV
1-70
KKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDI
70-140
GVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGT
140-210
NKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPV
210-280
IHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
280-329
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY