You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LLGL1
Lethal(2) giant larvae protein homolog 1

Protein Summary
Description
Cortical cytoskeleton protein found in a complex involved in maintaining cell polarity and epithelial integrity. Involved in the regulation of mitotic spindle orientation, proliferation, differentiation and tissue organization of neuroepithelial cells. Involved in axonogenesis through RAB10 activation thereby regulating vesicular membrane trafficking toward the axonal plasma membrane. This gene encodes a protein that is similar to a tumor suppressor in Drosophila. The protein is part of a cytoskeletal network and is associated with nonmuscle myosin II heavy chain and a kinase that specifically phosphorylates this protein at serine residues. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000316843
  • ENSP00000321537
  • ENSG00000131899
  • ENST00000640494
  • ENSP00000492144
  • ENSG00000284137

Symbol
  • DLG4
  • HUGL
  • HUGL1
  • DLG4
  • HUGL
  • LLGL
  • Lgl1
  • Mgl1
  • HUGL1
  • HUGL-1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
histone modification site profile
0.75
interacting protein
0.75
kinase perturbation
0.71
cellular component
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1142.09   (req: < 5)
Gene RIFs: 20   (req: <= 3)
Antibodies: 177   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1142.09   (req: >= 5)
Gene RIFs: 20   (req: > 3)
Antibodies: 177   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (3)
Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Tight junction
KEGG
Hippo signaling pathway
KEGG
Human papillomavirus infection
Name
Explore in Pharos
Explore in Source
Tight junction
Hippo signaling pathway
Human papillomavirus infection
Protein-Protein Interactions (79)
1 – 10 of 79
PARD6B
Tbio
Novelty: 0.11958639
p_int: 0.999917843
p_ni: 0.000082157
Score: 0.975
Data Source: BioPlex,STRINGDB
PRKCZ
Tchem
Family: Kinase
Novelty: 0.00267081
p_int: 0.999421931
p_ni: 0.000578069
Score: 0.922
Data Source: BioPlex,STRINGDB
KBTBD7
Tdark
Novelty: 1.01449275
p_int: 0.78213679
p_ni: 0.21786321
Score: 0.318
Data Source: BioPlex,STRINGDB
PRKCI
Tchem
Family: Kinase
Novelty: 0.01104604
Score: 0.947
Data Source: STRINGDB
SCRIB
Tbio
Novelty: 0.01369885
Score: 0.935
Data Source: STRINGDB
DLG3
Tbio
Novelty: 0.00904059
Score: 0.926
Data Source: STRINGDB
DLG1
Tbio
Novelty: 0.00644048
Score: 0.926
Data Source: STRINGDB
PARD6A
Tbio
Novelty: 0.10369583
Score: 0.902
Data Source: STRINGDB
BAZ2A
Tchem
Family: TF; Epigenetic
Novelty: 0.00120074
Score: 0.895
Data Source: STRINGDB
DLG2
Tbio
Novelty: 0.01593948
Score: 0.883
Data Source: STRINGDB
Publication Statistics
PubMed Score  1142.09

PubMed score by year
PubTator Score  475.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTG
1-70
LHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVT
70-140
VVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTK
140-210
ILIGYSRGLLVIWNQASQCVDHIFLGNQQLESLCWGRDSSTVVSSHSDGSYAVWSVDAGSFPTLQPTVAT
210-280
TPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRIIDFFTVHSTR
280-350
PEDEFDDPQALAVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQS
350-420
PQPVSSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQTDCEHADSLA
420-490
QAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQMVVAGTAGQVLVLELSDVPVEQAVSVAIIDLL
490-560
QDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLFDYQRKS
560-630
PVLARCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHD
630-700
VEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDGAHHGPTMWAGTNSGSVFAYALEVPAAAVGGEKRP
700-770
EQAVEAVLGKEVQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPK
770-840
VSAKTKFKLTAHEGCRVRKVALATFASVACEDYAETCLACLTNLGDVHVFSVPGLRPQVHYSCIRKEDIS
840-910
GIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSIL
910-980
LAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRN
980-1050
LAEDEAHACAILIK
1050-1064
MMKFRFRRQGADPQREKLKQELFAFNKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKIYGAPGVEFTGLHRDAATVTQMHFLTGQGRLLSLLDDSSLHLWEIVHHNGCAHLEEALSFQLPSRPGFDGASAPLSLTRVTVVLLVAASDIAALGTEGSSVFFLDVTTLTLLEGQTLAPGEVLRSVPDDYRCGKALGPVESLQGHLRDPTKILIGYSRGLLVIWNQASQCVDHIFLGNQQLESLCWGRDSSTVVSSHSDGSYAVWSVDAGSFPTLQPTVATTPYGPFPCKAINKILWRNCESGGHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRIIDFFTVHSTRPEDEFDDPQALAVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVASVPAKLWARIVSAGEQQSPQPVSSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQTDCEHADSLAQAAEDDWPPFRKVGCFDPYSDDPRLGVQKVALCKYTAQMVVAGTAGQVLVLELSDVPVEQAVSVAIIDLLQDREGFTWKGHERLSPRTGPLPWPAGFQPRVLVQCLPPAAVTAVTLHTEWSLVAFGTSHGFGLFDYQRKSPVLARCTLHPNDSLAMEGPLSRVKSLKKSLRQSFRRIRKSRVSGKKRAANASSKLQEANAQLAEQACPHDVEMTPVQRRIEPRSADDSLSGVVRCLYFADTFLRDGAHHGPTMWAGTNSGSVFAYALEVPAAAVGGEKRPEQAVEAVLGKEVQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVALATFASVACEDYAETCLACLTNLGDVHVFSVPGLRPQVHYSCIRKEDISGIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDINWPRDATQASYRIRESPKLSQANGTPSILLAPQSLDGSPDPAHSMGPDTPEPPEAALSPMSIDSATSADTTLDTTGDVTVEDVKDFLGSSEESEKNLRNLAEDEAHACAILIK