You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ANKRD1
Ankyrin repeat domain-containing protein 1

Protein Summary
Description
May play an important role in endothelial cell activation. May act as a nuclear transcription factor that negatively regulates the expression of cardiac genes. Induction seems to be correlated with apoptotic cell death in hepatoma cells. The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000371697
  • ENSP00000360762
  • ENSG00000148677

Symbol
  • C193
  • CARP
  • HA1A2
  • ALRP
  • CARP
  • C-193
  • CVARP
  • MCARP
  • bA320F15.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
biological process
0.98
molecular function
0.84
PubMedID
0.82
transcription factor perturbation
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 64.85   (req: < 5)
Gene RIFs: 31   (req: <= 3)
Antibodies: 229   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 64.85   (req: >= 5)
Gene RIFs: 31   (req: > 3)
Antibodies: 229   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 30
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
PPARA activates gene expression
Reactome
Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of lipids
PPARA activates gene expression
Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
Gene Ontology Terms (37)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Traceable Author Statement (TAS)
BHF-UCL
Protein-Protein Interactions (93)
1 – 10 of 93
HELZ2
Tdark
Family: Enzyme
Novelty: 0.28753695
Score: 0.916
Data Source: STRINGDB
TBL1XR1
Tbio
Novelty: 0.01064914
Score: 0.912
Data Source: STRINGDB
TBL1X
Tbio
Novelty: 0.0021757
Score: 0.912
Data Source: STRINGDB
SMARCD3
Tbio
Novelty: 0.04645544
Score: 0.908
Data Source: STRINGDB
CHD9
Tbio
Family: Epigenetic
Novelty: 0.10573131
Score: 0.906
Data Source: STRINGDB
CARM1
Tchem
Family: Epigenetic
Novelty: 0.0078817
Score: 0.904
Data Source: STRINGDB
CREBBP
Tchem
Family: Epigenetic
Novelty: 0.00127032
Score: 0.904
Data Source: STRINGDB
NCOA6
Tbio
Novelty: 0.01482918
Score: 0.9
Data Source: STRINGDB
NCOA2
Tbio
Novelty: 0.00643607
Score: 0.9
Data Source: STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
Score: 0.9
Data Source: STRINGDB
Publication Statistics
PubMed Score  64.85

PubMed score by year
PubTator Score  28.77

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAEL
1-70
KKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFL
70-140
SDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGA
140-210
KISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNI
210-280
KNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF
280-319
MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAELKKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGAKISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF