You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RALBP1
RalA-binding protein 1

Protein Summary
Description
Can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. Mediates ATP-dependent transport of S-(2,4-dinitrophenyl)-glutathione (DNP-SG) and doxorubicin (DOX) and is the major ATP-dependent transporter of glutathione conjugates of electrophiles (GS-E) and DOX in erythrocytes. Can catalyze transport of glutathione conjugates and xenobiotics, and may contribute to the multidrug resistance phenomenon. Serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 to switch off endocytosis, One of its substrates would be EPN1/Epsin. RALBP1 plays a role in receptor-mediated endocytosis and is a downstream effector of the small GTP-binding protein RAL (see RALA; MIM 179550). Small G proteins, such as RAL, have GDP-bound inactive and GTP-bound active forms, which shift from the inactive to the active state through the action of RALGDS (MIM 601619), which in turn is activated by RAS (see HRAS; MIM 190020) ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000019317
  • ENSP00000019317
  • ENSG00000017797
  • ENST00000383432
  • ENSP00000372924

Symbol
  • RLIP1
  • RLIP76
  • RIP1
  • RLIP1
  • RLIP76
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
kinase perturbation
0.98
transcription factor binding site profile
0.89
histone modification site profile
0.88
gene perturbation
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 122.95   (req: < 5)
Gene RIFs: 45   (req: <= 3)
Antibodies: 450   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 122.95   (req: >= 5)
Gene RIFs: 45   (req: > 3)
Antibodies: 450   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (27)
Rho GTPase cycle (R-HSA-194840)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Rho GTPase cycle
Reactome
Signal Transduction
Reactome
Signaling by Rho GTPases
Name
Explore in Pharos
Explore in Source
Rho GTPase cycle
Signal Transduction
Signaling by Rho GTPases
Gene Ontology Terms (18)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Physical Interaction (IPI)
UniProtKB
Protein-Protein Interactions (120)
1 – 10 of 120
REPS1
Tbio
Novelty: 0.1445037
p_int: 0.99999991
p_ni: 9.1e-8
Score: 0.974
Data Source: BioPlex,STRINGDB
MSANTD4
Tdark
Novelty: 0.19354839
p_int: 0.999999854
p_ni: 1e-9
p_wrong: 1.46e-7
Score: 0.214
Data Source: BioPlex,STRINGDB
REPS2
Tbio
Novelty: 0.0875
p_int: 0.999999842
p_ni: 9e-9
p_wrong: 1.49e-7
Score: 0.975
Data Source: BioPlex,STRINGDB
KIFC1
Tchem
Novelty: 0.00936802
p_int: 0.999999836
p_ni: 1.35e-7
p_wrong: 2.9e-8
Score: 0.183
Data Source: BioPlex,STRINGDB
AP2M1
Tbio
Novelty: 0.01240983
p_int: 0.999999747
p_ni: 2.53e-7
Score: 0.815
Data Source: BioPlex,STRINGDB
SAPCD2
Tbio
Novelty: 0.07060586
p_int: 0.999999366
p_ni: 6.34e-7
Data Source: BioPlex
GPS2
Tbio
Novelty: 0.01793637
p_int: 0.999998747
p_ni: 4.33e-7
p_wrong: 8.21e-7
Score: 0.705
Data Source: BioPlex,STRINGDB
GOLGA4
Tbio
Novelty: 0.0181571
p_int: 0.999997386
p_ni: 0.000002614
Data Source: BioPlex
CCDC6
Tbio
Novelty: 0.01216915
p_int: 0.999996485
p_ni: 0.000003515
Data Source: BioPlex
PPP4R1
Tbio
Family: Enzyme
Novelty: 0.14243726
p_int: 0.99999452
p_ni: 0.00000548
Score: 0.377
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  122.95

PubMed score by year
PubTator Score  100.33

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGK
1-70
KKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEK
70-140
HKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLP
140-210
AVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLT
210-280
KELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTV
280-350
QISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
350-420
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEIL
420-490
TEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSSESESESEDEEELQIILEDLQ
490-560
RQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAKAEQQAQEDEEPEWRGGAVQPPRDGVLEPKA
560-630
AKEQPKAGKEPAKPSPSRDRKETSI
630-655
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGIKDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSSESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAKAEQQAQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETSI